Phosphoenolpyruvate-dependent phosphotransferase system. Determined by X-ray diffraction at 1.7 Å resolution. Released 1 Aug 1996.
Explore 1PDO in 3D Show helices and sheets RCSB PDB PDBe
1PDO contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-8 | 5 | 1 |
| β-strand | 11 | 1 | 2 |
| α-helix | 13-25 | 13 | |
| β-strand | 31-34 | 4 | 1 |
| β-strand | 36 | 1 | 2 |
| β-strand | 38 | 1 | 3 |
| β-strand | 40 | 1 | 3 |
| α-helix | 42-53 | 12 | |
| β-strand | 62-66 | 5 | 1 |
| α-helix | 72-81 | 10 | |
| β-strand | 87-91 | 5 | 1 |
| α-helix | 95-105 | 11 | |
| α-helix | 111-124 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mannose permease | A | protein | 135 | Escherichia coli | P69797 (AlphaFold model) |
>1PDO_1 MANNOSE PERMEASE (chains A) TIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKG VLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVET GREGVKALKAKPFAG
Structure of the IIA domain of the mannose transporter from Escherichia coli at 1.7 angstroms resolution. Nunn, R.S., Markovic-Housley, Z., Genovesio-Taverne, J.C. et al. J Mol Biol (1996) 259:502-511. DOI 10.1006/jmbi.1996.0335 · PubMed
Other PDB entries of the same protein (UniProt P69797 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1PDO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.