Polycomb chromodomain complexed with the histone H3 tail containing trimethyllysine 27. Determined by X-ray diffraction at 1.76 Å resolution. Released 26 Aug 2003.
Explore 1PDQ in 3D Show helices and sheets RCSB PDB PDBe
1PDQ contains 3 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 24-37 | 14 | 1 |
| β-strand | 40-47 | 8 | 1 |
| α-helix | 52-54 | 3 | |
| β-strand | 56-59 | 4 | 1 |
| α-helix | 60-62 | 3 | |
| α-helix | 67-72 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-27 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polycomb protein | A | protein | 72 | Drosophila melanogaster | P26017 (AlphaFold model) |
| Histone H3.3 | B | protein | 18 | P84243 (AlphaFold model) |
>1PDQ_1 Polycomb protein (chains A) MKKHHHHHHDNATDDPVDLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILD RRLIDIYEQTNK
>1PDQ_2 Histone H3.3 (chains B) APRKQLATKAARKSAPST
Molecular basis for the discrimination of repressive methyl-lysine marks in histone H3 by Polycomb and HP1 chromodomains. Fischle, W., Wang, Y., Jacobs, S.A. et al. Genes Dev (2003) 17:1870-1881. DOI 10.1101/gad.1110503 · PubMed
Other PDB entries of the same protein (UniProt P26017 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1PDQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.