Pleckstrin homology domain of son of sevenless 1 (SOS1) with glycine-serine added to the N-terminus, NMR, 20 structures. Determined by solution NMR. Released 15 May 1997.
Explore 1PMS in 3D Show helices and sheets RCSB PDB PDBe
1PMS contains 2 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 436-444 | 9 | |
| β-strand | 463-467 | 5 | 1 |
| β-strand | 468 | 1 | 2 |
| β-strand | 476-480 | 5 | 1 |
| β-strand | 484-488 | 5 | 1 |
| β-strand | 507-512 | 6 | 1 |
| β-strand | 517-519 | 3 | 3 |
| β-strand | 524 | 1 | 4 |
| β-strand | 527 | 1 | 4 |
| β-strand | 531-534 | 4 | 3 |
| β-strand | 540-543 | 4 | 3 |
| β-strand | 544 | 1 | 2 |
| α-helix | 549-562 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SOS 1 | A | protein | 136 | Mus musculus | Q62245 (AlphaFold model) |
>1PMS_1 SOS 1 (chains A) GSKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCK SNHGQPRLPGASSAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDGNSVIFSAKSAE EKNNWMAALISLQYRS
The solution structure of the pleckstrin homology domain of mouse Son-of-sevenless 1 (mSos1). Koshiba, S., Kigawa, T., Kim, J.H. et al. J Mol Biol (1997) 269:579-591. DOI 10.1006/jmbi.1997.1041 · PubMed
Other PDB entries of the same protein (UniProt Q62245 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1PMS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.