Crk SH3 domain complexed with peptoid inhibitor. Determined by X-ray diffraction at 2.5 Å resolution. Released 6 Jan 1999.
Explore 1B07 in 3D Show helices and sheets RCSB PDB PDBe
1B07 contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 136-139 | 4 | 1 |
| β-strand | 143 | 1 | 2 |
| β-strand | 150 | 1 | 1 |
| β-strand | 153 | 1 | 2 |
| β-strand | 158-163 | 6 | 1 |
| β-strand | 169-173 | 5 | 1 |
| β-strand | 179-183 | 5 | 1 |
| α-helix | 184-186 | 3 | |
| β-strand | 187-189 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-10 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (proto-oncogene crk (crk)) | A | protein | 65 | Mus musculus | Q64010 (AlphaFold model) |
| Protein (SH3 peptoid inhibitor) | C | protein | 12 | Q62245 (AlphaFold model) |
>1B07_1 PROTEIN (PROTO-ONCOGENE CRK (CRK)) (chains A) GSAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYH HHHHH
>1B07_2 PROTEIN (SH3 PEPTOID INHIBITOR) (chains C) YEVPGPVPPRRR
| ID | Name | Formula | Copies |
|---|---|---|---|
| PYJ | Phenylethane | C8 H10 | 1 |
Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors. Nguyen, J.T., Turck, C.W., Cohen, F.E. et al. Science (1998) 282:2088-2092. DOI 10.1126/science.282.5396.2088 · PubMed
Other PDB entries of the same protein (UniProt Q64010 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1B07 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.