1PU9: Hat A1

Crystal Structure of Tetrahymena GCN5 with Bound Coenzyme A and a 19-residue Histone H3 Peptide. Determined by X-ray diffraction at 2.3 Å resolution. Released 23 Sept 2003.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Tetrahymena thermophila
Chains: 2
Atoms: 1,631
Mol. weight: 22.24 kDa
Ligands: COA
Released: 23 Sept 2003

Explore 1PU9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PU9 contains 6 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	50-54	5	1
α-helix	60-76	17
α-helix	82-89	8
β-strand	94-101	8	1
β-strand	105-115	11	1
β-strand	120-128	9	1
α-helix	130-132	3
α-helix	137-151	15
β-strand	156-161	6	1
α-helix	164-171	8
β-strand	175	1	1
α-helix	182-185	4
β-strand	186	1	2
β-strand	189	1	2
β-strand	196-201	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hat A1	A	protein	163	Tetrahymena thermophila	Q27198 (AlphaFold model)
Histone H3	B	protein	19		P61830 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1PU9_1 HAT A1 (chains A)
LLDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVI
GGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIG
YFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR

Sequence of entity 2 (B), FASTA

>1PU9_2 Histone H3 (chains B)
QTARKSTGGKAPRKQLASK

Ligands and cofactors

ID	Name	Formula	Copies
COA	Coenzyme a	C21 H36 N7 O16 P3 S	1

Primary citation

Structural basis for histone and phospho-histone binding by the GCN5 histone acetyltransferase. Clements, A., Poux, A.N., Lo, W.S. et al. Mol Cell (2003) 12:461-473. DOI 10.1016/S1097-2765(03)00288-0 · PubMed

Other PDB entries of the same protein (UniProt Q27198 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QST 1.7 Å, Crystal structure of tetrahymena GCN5
1QSR 2.0 Å, Crystal structure of tetrahymena GCN5 with bound acetyl-coenzyme a
1M1D 2.2 Å, Tetrahymena GCN5 with bound bisubstrate analog inhibitor
1QSN 2.2 Å, Crystal structure of tetrahymena GCN5 with bound coenzyme a and histone H3 peptide
1Q2C 2.25 Å, Crystal Structure of Tetrahymena GCN5 With Bound Coenzyme A and a 19-residue Histone H4…
1Q2D 2.25 Å, Crystal Structure of Tetrahymena GCN5 With Bound Coenzyme A and a 19-residue p53 peptide
1PUA 2.3 Å, Crystal Structure of Tetrahymena GCN5 with Bound Coenzyme A and a Phosphorylated,…
5GCN Catalytic domain of tetrahymena GCN5 histone acetyltransferase in complex with coenzyme a

Browse structure collections

About this viewer

MolViewer shows 1PU9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.