1Q0V: Tandem UIMs of Vps27

Solution Structure of Tandem UIMs of Vps27. Determined by solution NMR. Released 23 Dec 2003.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 655
Mol. weight: 9.37 kDa
Released: 23 Dec 2003

Explore 1Q0V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q0V contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	259-272	14
α-helix	304-324	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
hydrophilic protein; has cysteine rich putative zinc finger essential for function; Vps27p	A	protein	81	Saccharomyces cerevisiae	P40343 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Q0V_1 hydrophilic protein; has cysteine rich putative zinc finger essential for function; Vps27p (chains A)
MDRDYSTPEDEEELIRKAIELSLKESRNSASSEPIVPVVESKNEVKRQEIEEEEDPDLKA
AIQESLREAEEAKLRSERQKA

Primary citation

Solution structure of Vps27 UIM-ubiquitin complex important for endosomal sorting and receptor downregulation. Swanson, K.A., Kang, R.S., Stamenova, S.D. et al. EMBO J (2003) 22:4597-4606. DOI 10.1093/emboj/cdg471 · PubMed

Other PDB entries of the same protein (UniProt P40343 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1VFY 1.15 Å, Phosphatidylinositol-3-phosphate binding fyve domain of VPS27P protein from…
1O06 1.45 Å, Crystal structure of the Vps27p Ubiquitin Interacting Motif (UIM)
3R42 1.87 Å, Crystal structure of the yeast vps23 UEV domain in complex with a vps27 PSDP peptide
6NJG 2.35 Å, Ubiquitin Variant in Complex with Ubiquitin Interacting Motif
2PJW 3.01 Å, The Vps27/Hse1 complex is a GAT domain-based scaffold for ubiquitin-dependent sorting
1Q0W Solution structure of Vps27 amino-terminal UIM-ubiquitin complex
2KDI Solution structure of a Ubiquitin/UIM fusion protein

Browse structure collections

About this viewer

MolViewer shows 1Q0V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.