1Q0W: Vps27 amino-terminal UIM-ubiquitin complex

Solution structure of Vps27 amino-terminal UIM-ubiquitin complex. Determined by solution NMR. Released 7 Oct 2003.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 799
Mol. weight: 11.39 kDa
Released: 7 Oct 2003

Explore 1Q0W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q0W contains 7 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	258-273	16
α-helix	274-276	3

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	11-16	6	1
β-strand	22	1	2
α-helix	23-34	12
β-strand	41-45	5	1
β-strand	48-49	2	1
α-helix	50-51	2
β-strand	55	1	2
α-helix	56-59	4
α-helix	61-62	2
β-strand	66-71	6	1
α-helix	72-74	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting-associated protein VPS27	A	protein	24		P40343 (AlphaFold model)
Ubiquitin	B	protein	76	Saccharomyces cerevisiae	P0CG63 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Q0W_1 Vacuolar protein sorting-associated protein VPS27 (chains A)
YPEDEEELIRKAIELSLKESRNSA

Sequence of entity 2 (B), FASTA

>1Q0W_2 Ubiquitin (chains B)
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGG

Primary citation

Solution Structure of Vps27 UIM-Ubiquitin Complex Important for Endosomal Sorting and Receptor Downregulation. Swanson, K.A., Kang, R.S., Stamenova, S.D. et al. EMBO J (2003) 22:4597-4606. DOI 10.1093/emboj/cdg471 · PubMed

Other PDB entries of the same protein (UniProt P40343 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1VFY 1.15 Å, Phosphatidylinositol-3-phosphate binding fyve domain of VPS27P protein from…
1O06 1.45 Å, Crystal structure of the Vps27p Ubiquitin Interacting Motif (UIM)
3R42 1.87 Å, Crystal structure of the yeast vps23 UEV domain in complex with a vps27 PSDP peptide
6NJG 2.35 Å, Ubiquitin Variant in Complex with Ubiquitin Interacting Motif
2PJW 3.01 Å, The Vps27/Hse1 complex is a GAT domain-based scaffold for ubiquitin-dependent sorting
1Q0V Solution Structure of Tandem UIMs of Vps27
2KDI Solution structure of a Ubiquitin/UIM fusion protein

Browse structure collections

About this viewer

MolViewer shows 1Q0W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.