1Q0X: Anti-morphine Antibody 9B1 Unliganded Form

Anti-morphine Antibody 9B1 Unliganded Form. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Apr 2004.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,546
Mol. weight: 46.67 kDa
Released: 20 Apr 2004

Explore 1Q0X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q0X contains 15 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	33-39	7	7
β-strand	45-51	7	7
β-strand	57-59	3	7
α-helix	61-63	3
β-strand	67-72	6	6
β-strand	77-82	6	6
α-helix	84-86	3
β-strand	88-96	9	7
β-strand	100A-103	5	7
β-strand	107-111	5	7
α-helix	114-116	3
β-strand	117	1	8
β-strand	120-124	5	9
β-strand	137-147	11	9
β-strand	148	1	8
β-strand	153-157	4	10
α-helix	158-164	3
β-strand	166	1	10
β-strand	170-173	3	9
α-helix	174-176	3
β-strand	177-179	3	9
β-strand	184-194	11	9
β-strand	207-212	6	10
α-helix	213-215	3
β-strand	217-222	6	10

Chain L: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	9-13	4	2
β-strand	19-25	7	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	43-49	7	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-91	8	2
β-strand	96-98	3	2
β-strand	102-106	5	2
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-155	3	5
β-strand	159-161	3	4
α-helix	162-164	3
β-strand	165-166	2	4
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-198	8	5
β-strand	201-210	8	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab 9B1, light chain	L	protein	212	Mus musculus	P01723 (AlphaFold model)
Fab 9B1, heavy chain	H	protein	221	Mus musculus	Q9D9B8 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1Q0X_1 Fab 9B1, light chain (chains L)
DAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGV
PARFSGSLIGDKAALTITGAQTEDEAIYFCALWSNNKLVFGGGTKLTVLGQPKSSPTVTL
FPPSSEELSTAKATLVCTITDFYPGVVTVDWKVDGTPVTAGMETTQPSKQSNNKYMASSY
LTLTARAWERHSSYSCQVTHEGHSSNKTLSRA

Sequence of entity 2 (H), FASTA

>1Q0X_2 Fab 9B1, heavy chain (chains H)
EVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGDTIF
NEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARWVLDYYGMDYWGQGTSLTVSSA
STTPPSVYPLAPGGHHHHHHSAMVTLGCLVKGYFPEPVTVVWNKGSLSTGTHTFPAVLAA
DLYTLSSSVTVSASSWPGQSVTCNVAHPASSTKVDKKIAPS

Primary citation

Anchoring a cationic ligand: the structure of the Fab fragment of the anti-morphine antibody 9B1 and its complex with morphine. Pozharski, E., Wilson, M.A., Hewagama, A. et al. J Mol Biol (2004) 337:691-697. DOI 10.1016/j.jmb.2003.12.084 · PubMed

Other PDB entries of the same protein (UniProt P01723 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SM3 1.95 Å, Crystal structure of the tumor specific antibody SM3 complex with its peptide epitope
1P4B 2.35 Å, Three-Dimensional Structure Of a Single Chain Fv Fragment Complexed With The peptide…
3CFJ 2.6 Å, Crystal structure of catalytic elimination antibody 34E4, orthorhombic crystal form
3CFK 2.6 Å, Crystal structure of catalytic elimination antibody 34E4, triclinic crystal form
1P4I 2.8 Å, Crystal Structure of scFv against peptide GCN4

Browse structure collections

About this viewer

MolViewer shows 1Q0X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.