1Q25: N-terminal 3 domains of CI-MPR

Crystal structure of N-terminal 3 domains of CI-MPR. Determined by X-ray diffraction at 1.8 Å resolution. Released 29 Jun 2004.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Bos taurus
Chains: 1
Atoms: 3,763
Mol. weight: 49.05 kDa
Released: 29 Jun 2004

Explore 1Q25 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q25 contains 23 α-helices and 40 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 40 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
β-strand	17-21	5	1
α-helix	22-24	3
β-strand	26-30	5	1
β-strand	45-51	7	1
β-strand	56-62	7	1
α-helix	63-65	3
β-strand	66-69	4	2
β-strand	72-80	9	2
α-helix	81	1
β-strand	87-96	10	2
β-strand	103-108	6	2
β-strand	112-119	8	2
α-helix	120-122	3
α-helix	126-128	3
β-strand	133	1	3
β-strand	137-139	3	4
β-strand	145-147	3	4
α-helix	149-151	3
β-strand	156	1	5
β-strand	158-159	2	6
α-helix	160	1
β-strand	161	1	7
β-strand	168-171	4	6
β-strand	175	1	3
β-strand	178	1	5
α-helix	187-189	3
α-helix	191	1
β-strand	196-199	4	6
β-strand	204-208	5	6
β-strand	209-210	2	7
α-helix	213-214	2
β-strand	215-218	4	7
β-strand	221-227	7	7
α-helix	240-242	3
β-strand	243-249	7	7
β-strand	261-265	5	7
β-strand	269-275	7	7
α-helix	277-279	3
α-helix	282-284	3
β-strand	286-287	2	8
β-strand	291-292	2	9
α-helix	294-297	4
β-strand	301-302	2	9
α-helix	304-306	3
β-strand	317-320	4	10
β-strand	324-328	5	10
α-helix	334-336	3
α-helix	337-339	3
β-strand	346-350	5	10
β-strand	357-359	3	10
β-strand	366-371	6	8
β-strand	374-379	6	8
α-helix	383	1
β-strand	384	1	11
α-helix	385	1
α-helix	389	1
β-strand	390	1	11
α-helix	391	1
β-strand	392-399	8	8
β-strand	412-417	6	8
β-strand	420-427	8	8
α-helix	428-430	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cation-independent mannose 6-phosphate receptor	A	protein	432	Bos taurus	P08169 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Q25_1 cation-independent mannose 6-phosphate receptor (chains A)
AAGTQGAEFPELCSYTWEAVDTKNNMLYKINICGNMGVAQCGPSSAVCMHDLKTDSFHSV
GDSLLKTASRSLLEFNTTVNCKQQNHKIQSSITFLCGKTLGTPEFVTATDCVHYFEWRTT
AACKKNIFKANKEVPCYAFDRELKKHDLNPLIKTSGAYLVDDSDPDTSLFINVCRDIEVL
RASSPQVRVCPTGAAACLVRGDRAFDVGRPQEGLKLVSNDRLVLSYVKEGAGQPDFCDGH
SPAVTITFVCPSERREGTIPKLTAKSNCRFEIEWVTEYACHRDYLESRSCSLSSAQHDVA
VDLQPLSRVEASDSLFYTSEADEYTYYLSICGGSQAPICNKKDAAVCQVKKADSTQVKVA
GRPQNLTLRYSDGDLTLIYFGGEECSSGFQRMSVINFECNQTAGNNGRGAPVFTGEVDCT
YFFTWDTKYACV

Primary citation

Structure of uPAR, plasminogen, and sugar-binding sites of the 300 kDa mannose 6-phosphate receptor. Olson, L.J., Yammani, R.D., Dahms, N.M. et al. EMBO J (2004) 23:2019-2028. DOI 10.1038/sj.emboj.7600215 · PubMed

Other PDB entries of the same protein (UniProt P08169 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SZ0 2.1 Å, N-terminal 3 domains of CI-MPR bound to mannose 6-phosphate
1SYO 2.2 Å, N-terminal 3 domains of CI-MPR bound to mannose 6-phosphate
6UM1 3.46 Å, Structure of M-6-P/IGFII Receptor at pH 4.5
6UM2 4.32 Å, Structure of M-6-P/IGFII Receptor and IGFII complex
2KVA SOLUTION STRUCTURE OF CI-MPR ligand-free domain 5
2KVB Solution structure of CI-MPR domain 5 bound to N-acetylglucosaminyl…

Browse structure collections

About this viewer

MolViewer shows 1Q25 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.