2KVA: CI-MPR ligand-free domain 5

SOLUTION STRUCTURE OF CI-MPR ligand-free domain 5. Determined by solution NMR. Released 7 Jul 2010.

Method: Solution NMR
Organism: Bos taurus
Chains: 1
Atoms: 1,178
Mol. weight: 16.76 kDa
Released: 7 Jul 2010

Explore 2KVA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KVA contains 2 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	586-588	3	1
β-strand	593-596	4	2
β-strand	601-604	4	2
α-helix	606-608	3
β-strand	614-617	4	3
β-strand	621-625	5	3
β-strand	629	1	4
β-strand	640-646	7	3
β-strand	652-657	6	3
β-strand	659	1	4
β-strand	662-665	4	1
β-strand	668-673	6	1
β-strand	674	1	3
β-strand	688-694	7	1
β-strand	704-706	3	1
β-strand	713-719	7	1
α-helix	721-723	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cation-independent mannose-6-phosphate receptor	A	protein	148	Bos taurus	P08169 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KVA_1 Cation-independent mannose-6-phosphate receptor (chains A)
EAEAEFLSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACP
PDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDR
DAGVGFPEYQEEDNSTYNFRWYTSYACP

Primary citation

Structural basis for recognition of phosphodiester-containing lysosomal enzymes by the cation-independent mannose 6-phosphate receptor. Olson, L.J., Peterson, F.C., Castonguay, A. et al. Proc Natl Acad Sci U S A (2010) 107:12493-12498. DOI 10.1073/pnas.1004232107 · PubMed

Other PDB entries of the same protein (UniProt P08169 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Q25 1.8 Å, Crystal structure of N-terminal 3 domains of CI-MPR
1SZ0 2.1 Å, N-terminal 3 domains of CI-MPR bound to mannose 6-phosphate
1SYO 2.2 Å, N-terminal 3 domains of CI-MPR bound to mannose 6-phosphate
6UM1 3.46 Å, Structure of M-6-P/IGFII Receptor at pH 4.5
6UM2 4.32 Å, Structure of M-6-P/IGFII Receptor and IGFII complex
2KVB Solution structure of CI-MPR domain 5 bound to N-acetylglucosaminyl…

Browse structure collections

About this viewer

MolViewer shows 2KVA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.