1Q31: Tobacco Etch Virus Protease C151A mutant

Crystal Structure of the Tobacco Etch Virus Protease C151A mutant. Determined by X-ray diffraction at 2.7 Å resolution. Released 2 Nov 2004.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Tobacco etch virus
Chains: 2
Atoms: 3,680
Mol. weight: 55.21 kDa
Released: 2 Nov 2004

Explore 1Q31 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q31 contains 13 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	12-16	5
β-strand	18-25	8	1
β-strand	29-37	9	1
β-strand	40-43	4	1
α-helix	45-48	4
β-strand	53-59	7	1
β-strand	62-66	5	1
α-helix	69-71	3
β-strand	73-76	4	1
β-strand	83-86	4	1
β-strand	100	1	2
β-strand	108-111	4	2
β-strand	112-115	4	3
β-strand	122-125	4	3
β-strand	129-130	2	2
β-strand	132	1	2
β-strand	139-142	4	2
β-strand	154-157	4	2
β-strand	163-170	8	2
β-strand	177-181	5	2
α-helix	182-183	2
α-helix	186-191	6
β-strand	199-200	2	1
β-strand	208-211	4	2
β-strand	214-217	4	2
α-helix	236-238	3
β-strand	239-241	3	2

Chain B: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	12-16	5
β-strand	18-25	8	1
β-strand	29-37	9	1
β-strand	40-44	5	1
α-helix	45-48	4
β-strand	53-59	7	1
β-strand	62-66	5	1
α-helix	69-71	3
β-strand	73-76	4	1
β-strand	82-86	5	1
β-strand	100	1	4
β-strand	108-111	4	4
β-strand	112-113	2	5
α-helix	119-121	3
β-strand	124-125	2	5
β-strand	129-130	2	4
β-strand	132	1	4
β-strand	139-142	4	4
β-strand	154-157	4	4
β-strand	163-170	8	4
β-strand	177-181	5	4
α-helix	182-183	2
α-helix	186-191	6
β-strand	199-200	2	1
β-strand	208-211	4	4
β-strand	214-217	4	4
α-helix	236-238	3
β-strand	239-241	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear inclusion protein A	A, B	protein	242	Tobacco etch virus	P04517

Sequence of entity 1 (A, B), FASTA

>1Q31_1 Nuclear inclusion protein A (chains A, B)
GESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSL
HGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKS
MSSMVSDTSCTFPSSDGIFWKHWIQTKDGQAGSPLVSTRDGFIVGIHSASNFTNTNNYFT
SVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMSKPEEPFQPVKEATQLMNELVY
SQ

Primary citation

Crystal structure of tobacco etch virus protease shows the protein C terminus bound within the active site. Nunn, C.M., Jeeves, M., Cliff, M.J. et al. J Mol Biol (2005) 350:145-155. DOI 10.1016/j.jmb.2005.04.013 · PubMed

Other PDB entries of the same protein (UniProt P04517), best resolution first:

1LVM 1.8 Å, Catalytically active tobacco etch virus protease complexed with product
1LVB 2.2 Å, Catalytically inactive tobacco etch virus protease complexed with substrate
9R9W 3.34 Å, RNA-free helical (h8.5) virus-like particle composed of TEV coat protein
6SUQ 3.7 Å, Crystal Structure of TcdB2-TccC3-TEV

Browse structure collections

About this viewer

MolViewer shows 1Q31 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.