Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization. Determined by X-ray diffraction at 1.8 Å resolution. Released 27 Jan 2004.
Explore 1Q3O in 3D Show helices and sheets RCSB PDB PDBe
1Q3O contains 4 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 585-595 | 11 | 1 |
| β-strand | 604-608 | 5 | 1 |
| β-strand | 628-633 | 6 | 1 |
| α-helix | 638-641 | 4 | |
| β-strand | 649-653 | 5 | 1 |
| β-strand | 656-657 | 2 | 1 |
| α-helix | 663-672 | 10 | |
| β-strand | 676-685 | 10 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 583-595 | 13 | 1 |
| β-strand | 604-608 | 5 | 1 |
| β-strand | 628-633 | 6 | 1 |
| α-helix | 638-642 | 5 | |
| β-strand | 649-653 | 5 | 1 |
| β-strand | 656-657 | 2 | 1 |
| α-helix | 663-672 | 10 | |
| β-strand | 676-688 | 13 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Shank1 | A, B | protein | 109 | Rattus norvegicus | Q9WV48 (AlphaFold model) |
>1Q3O_1 Shank1 (chains A, B) GSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWR AGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDM
Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization. Im, Y.J., Lee, J.H., Park, S.H. et al. J Biol Chem (2003) 278:48099-48104. DOI 10.1074/jbc.M306919200 · PubMed
Other PDB entries of the same protein (UniProt Q9WV48 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1Q3O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.