1Q3O: Shank1

Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization. Determined by X-ray diffraction at 1.8 Å resolution. Released 27 Jan 2004.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,722
Mol. weight: 24.55 kDa
Released: 27 Jan 2004

Explore 1Q3O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q3O contains 4 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	585-595	11	1
β-strand	604-608	5	1
β-strand	628-633	6	1
α-helix	638-641	4
β-strand	649-653	5	1
β-strand	656-657	2	1
α-helix	663-672	10
β-strand	676-685	10	1

Chain B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	583-595	13	1
β-strand	604-608	5	1
β-strand	628-633	6	1
α-helix	638-642	5
β-strand	649-653	5	1
β-strand	656-657	2	1
α-helix	663-672	10
β-strand	676-688	13	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Shank1	A, B	protein	109	Rattus norvegicus	Q9WV48 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1Q3O_1 Shank1 (chains A, B)
GSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWR
AGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDM

Primary citation

Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization. Im, Y.J., Lee, J.H., Park, S.H. et al. J Biol Chem (2003) 278:48099-48104. DOI 10.1074/jbc.M306919200 · PubMed

Other PDB entries of the same protein (UniProt Q9WV48 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A9B 2.0 Å, Crystal structure of Shank1 PDZ domain with ARAP3-derived peptide
1Q3P 2.25 Å, Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and…
3QJM 2.31 Å, Structural flexibility of Shank PDZ domain is important for its binding to different…
3QJN 2.71 Å, Structural flexibility of Shank PDZ domain is important for its binding to different…
3L4F 2.8 Å, Crystal Structure of betaPIX Coiled-Coil Domain and Shank PDZ Complex

Browse structure collections

About this viewer

MolViewer shows 1Q3O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.