3L4F: BetaPIX Coiled-Coil Domain and Shank PDZ Complex

Crystal Structure of betaPIX Coiled-Coil Domain and Shank PDZ Complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 16 Feb 2010.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 2,309
Mol. weight: 36.62 kDa
Released: 16 Feb 2010

Explore 3L4F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L4F contains 5 α-helices and 7 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	589-637	49
β-strand	641-645	5	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	588-636	49

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	592-634	43

Chain D: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	663-667	5	1
β-strand	676-681	6	1
β-strand	700-705	6	1
α-helix	710-714	5
β-strand	721-725	5	1
β-strand	729	1	1
α-helix	735-744	10
β-strand	748-754	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho guanine nucleotide exchange factor 7	A, B, C	protein	61	Rattus norvegicus	O55043 (AlphaFold model)
SH3 and multiple ankyrin repeat domains protein 1	D	protein	132	Rattus norvegicus	Q9WV48 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3L4F_1 Rho guanine nucleotide exchange factor 7 (chains A, B, C)
MEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETN
L

Sequence of entity 2 (D), FASTA

>3L4F_2 SH3 and multiple ankyrin repeat domains protein 1 (chains D)
MGSSHHHHHHSQDPLVPRGSGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPT
PAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKV
VMVTRHPDMDEA

Primary citation

Structural basis for asymmetric association of the betaPIX coiled coil and shank PDZ. Im, Y.J., Kang, G.B., Lee, J.H. et al. J Mol Biol (2010) 397:457-466. DOI 10.1016/j.jmb.2010.01.048 · PubMed

Other PDB entries of the same protein (UniProt O55043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2G6F 0.92 Å, Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide…
2DF6 1.3 Å, Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide…
2AK5 1.85 Å, beta PIX-SH3 complexed with a Cbl-b peptide
2P4R 2.0 Å, Structural basis for a novel interaction between AIP4 and beta-PIX
3QJN 2.71 Å, Structural flexibility of Shank PDZ domain is important for its binding to different…
2W6B 2.8 Å, Crystal Structure of the Trimeric beta-PIX Coiled-Coil Domain

Browse structure collections

About this viewer

MolViewer shows 3L4F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.