1Q5Z: SipA

Crystal Structure of the C-terminal Actin Binding Domain of Salmonella Invasion Protein A (SipA). Determined by X-ray diffraction at 1.8 Å resolution. Released 7 Oct 2003.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Salmonella typhimurium
Chains: 1
Atoms: 1,356
Mol. weight: 19.45 kDa
Released: 7 Oct 2003

Explore 1Q5Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q5Z contains 14 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	519	1	1
α-helix	525-527	3
α-helix	529-530	2
α-helix	531-534	4
α-helix	541-552	12
α-helix	554	1
β-strand	555	1	1
α-helix	556	1
α-helix	561-574	14
α-helix	579-589	11
α-helix	592-594	3
α-helix	596-610	15
α-helix	615-629	15
α-helix	635-637	3
α-helix	640-649	10
α-helix	654-656	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SipA	A	protein	177	Salmonella typhimurium	P0CL52 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Q5Z_1 SipA (chains A)
GPVDKAGTTDNDNSQTDKTGPFSGLKFKQNSFLSTVPSVTNMHSMHFDARETFLGVIRKA
LEPDTSTPFPVRRAFDGLRAEILPNDTIKSAALKAQCSDIDKHPELKAKMETLKEVITHH
PQKEKLAEIALQFAREAGLTRLKGETDYVLSNVLDGLIGDGSWRAGPAYESYLNKPG

Primary citation

Salmonella SipA polymerizes actin by stapling filaments with nonglobular protein arms. Lilic, M., Galkin, V.E., Orlova, A. et al. Science (2003) 301:1918-1921. DOI 10.1126/science.1088433 · PubMed

Other PDB entries of the same protein (UniProt P0CL52 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FM9 2.0 Å, Structure of Salmonella SipA residues 48-264
2FM8 2.2 Å, Crystal Structure of the Salmonella Secretion Chaperone InvB in Complex with SipA
8C4E 2.6 Å, F-actin decorated by SipA426-685
8C4C 2.7 Å, F-actin decorated by SipA497-669
8UEE 3.2 Å, Atomic structure of Salmonella SipA/F-actin complex by cryo-EM
8VFM 3.6 Å, Salmonella effector protein SipA decorated actin filament

Browse structure collections

About this viewer

MolViewer shows 1Q5Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.