Crystal Structure of the C-Terminal SH2 Domain of the P85 alpha Regulatory Subunit of Phosphoinositide 3-Kinase: An SH2 domain mimicking its own substrate. Determined by X-ray diffraction at 1.8 Å resolution. Released 27 Oct 1999.
Explore 1QAD in 3D Show helices and sheets RCSB PDB PDBe
1QAD contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| α-helix | 8-10 | 3 | |
| β-strand | 12-15 | 4 | 1 |
| α-helix | 18-25 | 8 | |
| α-helix | 28-29 | 2 | |
| β-strand | 32-37 | 6 | 1 |
| β-strand | 44-50 | 7 | 1 |
| β-strand | 53-59 | 7 | 1 |
| β-strand | 60-62 | 3 | 2 |
| β-strand | 65-67 | 3 | 2 |
| β-strand | 75 | 1 | 2 |
| α-helix | 78-87 | 10 | |
| α-helix | 90-92 | 3 | |
| β-strand | 103-104 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PI3-kinase P85 alpha subunit | A | protein | 111 | Bos taurus | P23727 (AlphaFold model) |
>1QAD_1 PI3-KINASE P85 ALPHA SUBUNIT (chains A) EDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVIN KTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
Crystal structure of the C-terminal SH2 domain of the p85alpha regulatory subunit of phosphoinositide 3-kinase: an SH2 domain mimicking its own substrate. Hoedemaeker, F.J., Siegal, G., Roe, S.M. et al. J Mol Biol (1999) 292:763-770. DOI 10.1006/jmbi.1999.3111 · PubMed
Other PDB entries of the same protein (UniProt P23727 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1QAD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.