6MRP: Bovine p85a BH domain R228E mutant

Structure of the Bovine p85a BH domain R228E mutant. Determined by X-ray diffraction at 2.4 Å resolution. Released 30 Jan 2019.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Bos taurus
Chains: 2
Atoms: 2,954
Mol. weight: 48.95 kDa
Released: 30 Jan 2019

Explore 6MRP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MRP contains 24 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	118-121	4
α-helix	130-143	14
α-helix	158-164	7
α-helix	174-176	3
α-helix	179-192	14
α-helix	200-207	8
α-helix	216-227	12
α-helix	234-251	18
α-helix	254-257	4
α-helix	261-273	13
α-helix	281-295	15

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	115-117	3
α-helix	118-121	4
α-helix	130-143	14
α-helix	158-164	7
α-helix	174-176	3
α-helix	179-192	14
α-helix	200-208	9
α-helix	216-227	12
α-helix	234-251	18
α-helix	254-257	4
α-helix	261-269	9
α-helix	270-274	5
α-helix	281-295	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase regulatory subunit alpha	A, B	protein	220	Bos taurus	P23727 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6MRP_1 Phosphatidylinositol 3-kinase regulatory subunit alpha (chains A, B)
GPLGSTEADSQQASTLPDLAEQFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNPA
ELRQLLDCDTASLDLEMFDVHVLADAFKRYLLDLPNPVIPVAVSSELISLAPEVQSSEEY
IQLLKKLIESPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSELFSPLLFRFPAAS
SENTEHLIKIIEILISTEWNERQPAPALPPKPPKPTTVAN

Primary citation

Insight into the PTEN - p85 alpha interaction and lipid binding properties of the p85 alpha BH domain. Marshall, J.D.S., Mellor, P., Ruan, X. et al. Oncotarget (2018) 9:36975-36992. DOI 10.18632/oncotarget.26432 · PubMed

Other PDB entries of the same protein (UniProt P23727 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QAD 1.8 Å, Crystal Structure of the C-Terminal SH2 Domain of the P85 alpha Regulatory Subunit of…
6D85 2.2 Å, Structure of the Bovine p85a BH domain E217K mutant
6D81 2.25 Å, Structure of the Bovine p85a BH domain
8S3R 2.28 Å, Human PI3KDELTA in complex with pyridazinone inhibitor 7
6D86 2.3 Å, Structure of the Bovine p85a BH domain
6D82 2.41 Å, Structure of the Bovine p85a BH domain
7JIS 2.42 Å, Human PI3KDELTA in complex with compound 2F
8BCY 2.43 Å, Human PI3KDELTA in complex with compound 13
9L3R 2.5 Å, Human PI3KDELTA in complex with Zandelisib
6OCO 2.58 Å, Human PI3KDELTA in complex with compound 6
5DXU 2.64 Å, p110delta/p85alpha with GDC-0326
6D87 2.7 Å, Structure of the Bovine p85alpha BH domain, R262T mutant

Browse structure collections

About this viewer

MolViewer shows 6MRP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.