1QBL: FAB E8 (FABE8A) X-ray structure

FAB E8 (FABE8A) X-ray structure at 2.26 Å resolution. Determined by X-ray diffraction at 2.26 Å resolution. Released 2 Dec 1998.

Method: X-ray diffraction
Resolution: 2.26 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,649
Mol. weight: 47.17 kDa
Released: 2 Dec 1998

Explore 1QBL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QBL contains 16 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	7
β-strand	45-51	7	7
β-strand	58-60	3	7
β-strand	68-73	6	6
α-helix	74-76	3
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-99	8	7
β-strand	105-107	3	7
β-strand	111-115	5	7
β-strand	121	1	8
α-helix	122-123	2
β-strand	124-128	5	9
α-helix	132-134	3
β-strand	139-149	11	9
β-strand	150	1	8
β-strand	155-158	4	10
α-helix	159-161	3
β-strand	163	1	10
β-strand	167-170	4	9
α-helix	171-172	2
β-strand	175	1	11
β-strand	178	1	11
β-strand	179-188	10	9
β-strand	198-203	6	10
α-helix	204-206	3
β-strand	208-213	6	10

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	97	1
β-strand	98	1	2
α-helix	99	1
β-strand	102-106	5	2
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-155	3	5
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-197	7	5
β-strand	205-210	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FABE8A	L	protein	214	Mus musculus	P01635 (AlphaFold model)
FABE8A	H	protein	219	Mus musculus

Sequence of entity 1 (L), FASTA

>1QBL_1 FABE8A (chains L)
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPS
RFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPWTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1QBL_2 FABE8A (chains H)
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEKGLEWIGRIDPASGNTKY
DPKFQDKATITADTSSNTAYLQLSSLTSEDTAVYYCAGYDYGNFDYWGQGTTLTVSSAET
TPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYT
LTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNC

Primary citation

Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution and FabE8 to 2.26 A resolution. Mylvaganam, S.E., Paterson, Y., Getzoff, E.D. J Mol Biol (1998) 281:301-322. DOI 10.1006/jmbi.1998.1942 · PubMed

Other PDB entries of the same protein (UniProt P01635 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1A2Y 1.5 Å, Hen egg white lysozyme, D18A mutant, in complex with mouse monoclonal antibody D1.3
1VFA 1.8 Å, Bound water molecules and conformational stabilization help mediate an antigen-antibody…
1VFB 1.8 Å, Bound water molecules and conformational stabilization help mediate an antigen-antibody…
1WEJ 1.8 Å, IgG1 FAB fragment (of E8 antibody) complexed with horse cytochrome C at 1.8 a resolution
1KIQ 1.85 Å, Fv mutant y(b 101)F (vh domain) of mouse monoclonal antibody D1.3 complexed with hen egg…
1DVF 1.9 Å, Idiotopic antibody D1.3 fv fragment-antiidiotopic antibody E5.2 fv fragment complex
1A7O 2.0 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) R96L deletion mutant on…
1A7Q 2.0 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) high affinity expressed…
1A7N 2.01 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) variant for chain L…
1A7P 2.01 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) engineered mutant…
1A7R 2.01 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) variant chain L GLU81->asp
1KIP 2.1 Å, Fv mutant y(b 32)A (vh domain) of mouse monoclonal antibody D1.3 complexed with hen egg…

Browse structure collections

About this viewer

MolViewer shows 1QBL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.