1WEJ: IgG1 FAB fragment

IgG1 FAB fragment (of E8 antibody) complexed with horse cytochrome C at 1.8 a resolution. Determined by X-ray diffraction at 1.8 Å resolution. Released 9 Dec 1998.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Mus musculus, Equus caballus
Chains: 3
Atoms: 4,846
Mol. weight: 59.94 kDa
Ligands: HEC, ZN
Released: 9 Dec 1998

Explore 1WEJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WEJ contains 25 α-helices and 44 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain F: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	24-26	3
α-helix	38	1
β-strand	39	1	11
α-helix	50-54	5
β-strand	58	1	11
α-helix	61-69	9
α-helix	71-74	4
α-helix	88-101	14

Chain H: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
α-helix	7-9	3
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	7
β-strand	45-51	7	7
β-strand	58-60	3	7
α-helix	62-64	3
β-strand	68-73	6	6
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-99	8	7
β-strand	105-107	3	7
β-strand	111-115	5	7
β-strand	121	1	8
β-strand	124-128	5	9
α-helix	129-131	3
α-helix	132-135	4
β-strand	139-149	11	9
β-strand	150	1	8
β-strand	155-158	4	10
α-helix	159-161	3
β-strand	167-169	3	9
α-helix	170-172	3
β-strand	173-175	3	9
β-strand	178-188	11	9
β-strand	198-203	6	10
α-helix	204-206	3
β-strand	208-213	6	10

Chain L: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	97	1
β-strand	98	1	2
α-helix	99	1
β-strand	102-106	5	2
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-155	3	5
β-strand	159-163	5	4
α-helix	164-165	2
α-helix	167	1
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-198	8	5
β-strand	201-210	10	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E8 antibody	L	protein	214	Mus musculus	P01635 (AlphaFold model)
E8 antibody	H	protein	223	Mus musculus
Cytochrome C	F	protein	105	Equus caballus	P00004 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1WEJ_1 E8 ANTIBODY (chains L)
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPS
RFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPWTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1WEJ_2 E8 ANTIBODY (chains H)
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEKGLEWIGRIDPASGNTKY
DPKFQDKATITADTSSNTAYLQLSSLTSEDTAVYYCAGYDYGNFDYWGQGTTLTVSSAET
TPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYT
LTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNCGGDC

Sequence of entity 3 (F), FASTA

>1WEJ_3 CYTOCHROME C (chains F)
XGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITW
KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE

Ligands and cofactors

ID	Name	Formula	Copies
HEC	Heme C	C34 H36 Fe N4 O4	1
ZN	Zinc ion	Zn	1

Primary citation

Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution and FabE8 to 2.26 A resolution. Mylvaganam, S.E., Paterson, Y., Getzoff, E.D. J Mol Biol (1998) 281:301-322. DOI 10.1006/jmbi.1998.1942 · PubMed

Other PDB entries of the same protein (UniProt P01635 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1A2Y 1.5 Å, Hen egg white lysozyme, D18A mutant, in complex with mouse monoclonal antibody D1.3
1VFA 1.8 Å, Bound water molecules and conformational stabilization help mediate an antigen-antibody…
1VFB 1.8 Å, Bound water molecules and conformational stabilization help mediate an antigen-antibody…
1KIQ 1.85 Å, Fv mutant y(b 101)F (vh domain) of mouse monoclonal antibody D1.3 complexed with hen egg…
1DVF 1.9 Å, Idiotopic antibody D1.3 fv fragment-antiidiotopic antibody E5.2 fv fragment complex
1A7O 2.0 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) R96L deletion mutant on…
1A7Q 2.0 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) high affinity expressed…
1A7N 2.01 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) variant for chain L…
1A7P 2.01 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) engineered mutant…
1A7R 2.01 Å, Fv fragment of mouse monoclonal antibody D1.3 (balb/c, IgG1, K) variant chain L GLU81->asp
1KIP 2.1 Å, Fv mutant y(b 32)A (vh domain) of mouse monoclonal antibody D1.3 complexed with hen egg…
1QBL 2.26 Å, FAB E8 (FABE8A) X-ray structure at 2.26 Å resolution

Browse structure collections

About this viewer

MolViewer shows 1WEJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.