FAB E8B antibody, X-ray structure at 2.37 Å resolution. Determined by X-ray diffraction at 2.37 Å resolution. Released 27 Jan 1999.
Explore 1QBM in 3D Show helices and sheets RCSB PDB PDBe
1QBM contains 14 α-helices and 41 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 6 |
| β-strand | 10-12 | 3 | 7 |
| β-strand | 17-25 | 9 | 6 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 7 |
| β-strand | 45-52 | 8 | 7 |
| β-strand | 57-60 | 4 | 7 |
| α-helix | 62-64 | 3 | |
| β-strand | 68-73 | 6 | 6 |
| β-strand | 78-84 | 7 | 6 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 7 |
| β-strand | 105-107 | 3 | 7 |
| β-strand | 111-115 | 5 | 7 |
| α-helix | 121-123 | 3 | |
| β-strand | 124-128 | 5 | 8 |
| α-helix | 132-134 | 3 | |
| β-strand | 139-149 | 11 | 8 |
| β-strand | 155-158 | 4 | 9 |
| α-helix | 159-161 | 3 | |
| β-strand | 163 | 1 | 9 |
| β-strand | 167-169 | 3 | 8 |
| α-helix | 170-172 | 3 | |
| β-strand | 173-175 | 3 | 8 |
| β-strand | 178-188 | 11 | 8 |
| β-strand | 198-203 | 6 | 9 |
| β-strand | 208-213 | 6 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-90 | 6 | 2 |
| α-helix | 97 | 1 | |
| β-strand | 98 | 1 | 2 |
| α-helix | 99 | 1 | |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 111 | 1 | 3 |
| β-strand | 114-118 | 5 | 4 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-125 | 4 | |
| β-strand | 129-139 | 11 | 4 |
| β-strand | 140 | 1 | 3 |
| β-strand | 144-150 | 7 | 5 |
| β-strand | 153-155 | 3 | 5 |
| β-strand | 159-163 | 5 | 4 |
| β-strand | 173-182 | 10 | 4 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-198 | 8 | 5 |
| α-helix | 204 | 1 | |
| β-strand | 205-210 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E8B antibody | L | protein | 214 | Mus musculus | P01635 (AlphaFold model) |
| E8B antibody | H | protein | 219 | Mus musculus |
>1QBM_1 E8B ANTIBODY (chains L) DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPS RFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPWTFGGGTKLEIKRADAAPTVSIFPP SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1QBM_2 E8B ANTIBODY (chains H) EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEKGLEWIGRIDPASGNTKY DPKFQDKATITADTSSNTAYLQLSSLTSEDTAVYYCAGYDYGNFDYWGQGTTLTVSSAET TPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYT LSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNC
Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution and FabE8 to 2.26 A resolution. Mylvaganam, S.E., Paterson, Y., Getzoff, E.D. J Mol Biol (1998) 281:301-322. DOI 10.1006/jmbi.1998.1942 · PubMed
Other PDB entries of the same protein (UniProt P01635 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1QBM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.