1QCQ: Ubiquitin conjugating enzyme

Ubiquitin conjugating enzyme. Determined by X-ray diffraction at 2.7 Å resolution. Released 17 May 1999.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,161
Mol. weight: 16.47 kDa
Released: 17 May 1999

Explore 1QCQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QCQ contains 6 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2-14	13
β-strand	22-27	6	1
β-strand	30-39	10	1
β-strand	40	1	2
α-helix	41	1
β-strand	47	1	2
β-strand	50-56	7	1
β-strand	67-70	4	1
β-strand	76	1	3
β-strand	79	1	3
β-strand	84	1	1
β-strand	85	1	3
α-helix	88-90	3
α-helix	100-112	13
α-helix	122-130	9
α-helix	132-146	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (ubiquitin conjugating enzyme)	A	protein	148	Saccharomyces cerevisiae	P15731 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QCQ_1 PROTEIN (UBIQUITIN CONJUGATING ENZYME) (chains A)
MSSSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTD
YPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPL
VPEIAHIYKTDRPKYEATAREWTKKYAV

Primary citation

Tertiary structures of class I ubiquitin-conjugating enzymes are highly conserved: crystal structure of yeast Ubc4. Cook, W.J., Jeffrey, L.C., Xu, Y. et al. Biochemistry (1993) 32:13809-13817. DOI 10.1021/bi00213a009 · PubMed

Other PDB entries of the same protein (UniProt P15731 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AIE 2.8 Å, Not4 ring domain in complex with Ubc4
8J1R 3.52 Å, cryo-EM structures of Ufd4 in complex with Ubc4-Ub
9M7O 4.14 Å, Cryo-EM structure of Ufd2/Ubc4-ub complex with K29triUb(monomeric conformation)
9KHS 4.31 Å, Cryo-EM structure of Ufd2/Ubc4-Ub in complex with K29-linked diUb (monomeric conformation)
9KHT 4.85 Å, cryo-EM structure of Ufd2/Ubc4-Ub in complex with K29-linked triUb (dimeric conformation)

Browse structure collections

About this viewer

MolViewer shows 1QCQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.