1QDV: KV1.2 voltage-gated potassium channel

N-terminal domain, voltage-gated potassium channel KV1.2 residues 33-131. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Sept 2000.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 3,608
Mol. weight: 47.81 kDa
Released: 20 Sept 2000

Explore 1QDV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QDV contains 24 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	34-39	6	1
β-strand	42-47	6	1
α-helix	48-51	4
α-helix	62-65	4
α-helix	66-68	3
β-strand	69-70	2	1
β-strand	75-78	4	1
α-helix	82-93	12
α-helix	106-115	10
α-helix	120-130	11

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	34-39	6	2
β-strand	42-47	6	2
α-helix	48-52	5
α-helix	62-65	4
α-helix	66-68	3
β-strand	69-70	2	2
β-strand	75-78	4	2
α-helix	85-93	9
α-helix	106-116	11
α-helix	120-130	11

Chain D: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	34-39	6	4
β-strand	42-47	6	4
α-helix	48-52	5
α-helix	62-65	4
α-helix	66-68	3
β-strand	69-70	2	4
β-strand	75-78	4	4
α-helix	85-93	9
α-helix	106-115	10
α-helix	120-129	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KV1.2 voltage-gated potassium channel	A, B, C, D	protein	99	Rattus norvegicus	P63142 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1QDV_1 KV1.2 VOLTAGE-GATED POTASSIUM CHANNEL (chains A, B, C, D)
ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYY
QSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEG

Primary citation

The polar T1 interface is linked to conformational changes that open the voltage-gated potassium channel. Minor, D.L., Lin, Y.F., Mobley, B.C. et al. Cell (2000) 102:657-670. DOI 10.1016/S0092-8674(00)00088-X · PubMed

Other PDB entries of the same protein (UniProt P63142 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DSX 1.6 Å, KV1.2 T1 domain, residues 33-119, T46V mutant
1QDW 2.1 Å, N-terminal domain, voltage-gated potassium channel KV1.2 residues 33-119
4JTA 2.5 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin
4JTD 2.54 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of…
8VCH 2.55 Å, Voltage gated potassium ion channel Kv1.2 W366F, C-type inactivated
4JTC 2.56 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+
2A79 2.9 Å, Mammalian Shaker Kv1.2 potassium channel- beta subunit complex
3LNM 2.9 Å, F233W mutant of the Kv2.1 paddle-Kv1.2 chimera channel
3LUT 2.9 Å, A Structural Model for the Full-length Shaker Potassium Channel Kv1.2
6EBL 3.0 Å, The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic…
7SIZ 3.1 Å, C-type inactivation in a voltage gated K+ channel
8VC4 3.17 Å, Voltage gated potassium ion channel Kv1.2 in Sodium

Browse structure collections

About this viewer

MolViewer shows 1QDV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.