1QDW: KV1.2 voltage-gated potassium channel
N-terminal domain, voltage-gated potassium channel KV1.2 residues 33-119. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Sept 2000.
- Method
- X-ray diffraction
- Resolution
- 2.1 Å
- Organism
- Rattus norvegicus
- Chains
- 8
- Atoms
- 6,491
- Mol. weight
- 83.98 kDa
- Released
- 20 Sept 2000
Explore 1QDW in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1QDW contains 39 α-helices and 32 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 34-39 | 6 | 1 |
| β-strand | 42-47 | 6 | 1 |
| α-helix | 48-52 | 5 | |
| α-helix | 65-68 | 4 | |
| β-strand | 69-70 | 2 | 1 |
| β-strand | 75-78 | 4 | 1 |
| α-helix | 85-93 | 9 | |
| α-helix | 106-116 | 11 | |
Chain B: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 34-39 | 6 | 2 |
| β-strand | 42-47 | 6 | 2 |
| α-helix | 48-52 | 5 | |
| α-helix | 62-66 | 5 | |
| β-strand | 69-70 | 2 | 2 |
| β-strand | 75-78 | 4 | 2 |
| α-helix | 82-94 | 13 | |
| α-helix | 106-115 | 10 | |
Chain C: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 34-39 | 6 | 3 |
| β-strand | 42-47 | 6 | 3 |
| α-helix | 48-52 | 5 | |
| α-helix | 62-65 | 4 | |
| α-helix | 66-68 | 3 | |
| β-strand | 69-70 | 2 | 3 |
| α-helix | 71-73 | 3 | |
| β-strand | 75-78 | 4 | 3 |
| α-helix | 82-93 | 12 | |
| α-helix | 106-115 | 10 | |
Chain D: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 34-39 | 6 | 4 |
| β-strand | 42-47 | 6 | 4 |
| α-helix | 48-51 | 4 | |
| α-helix | 62-65 | 4 | |
| α-helix | 66-68 | 3 | |
| β-strand | 69-70 | 2 | 4 |
| β-strand | 75-78 | 4 | 4 |
| α-helix | 82-93 | 12 | |
| α-helix | 106-115 | 10 | |
Chains E and F: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 34-39 | 6 | 5 |
| β-strand | 42-47 | 6 | 5 |
| α-helix | 48-52 | 5 | |
| α-helix | 62-65 | 4 | |
| α-helix | 66-68 | 3 | |
| β-strand | 69-70 | 2 | 5 |
| β-strand | 75-78 | 4 | 5 |
| α-helix | 82-93 | 12 | |
| α-helix | 106-115 | 10 | |
Chain G: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 34-39 | 6 | 7 |
| β-strand | 42-47 | 6 | 7 |
| α-helix | 48-51 | 4 | |
| α-helix | 62-65 | 4 | |
| α-helix | 66-68 | 3 | |
| β-strand | 69-70 | 2 | 7 |
| β-strand | 75-78 | 4 | 7 |
| α-helix | 82-94 | 13 | |
| α-helix | 106-115 | 10 | |
Chain H: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 35-39 | 5 | 8 |
| β-strand | 42-46 | 5 | 8 |
| α-helix | 48-52 | 5 | |
| α-helix | 62-65 | 4 | |
| α-helix | 66-68 | 3 | |
| β-strand | 69-70 | 2 | 8 |
| β-strand | 75-78 | 4 | 8 |
| α-helix | 82-93 | 12 | |
| α-helix | 106-115 | 10 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| KV1.2 voltage-gated potassium channel | A, B, C, D, E, F, G, H | protein | 87 | Rattus norvegicus | P63142 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA
>1QDW_1 KV1.2 VOLTAGE-GATED POTASSIUM CHANNEL (chains A, B, C, D, E, F, G, H)
ERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYY
QSGGRLRRPVNVPLDIFSEEIRFYELG
Primary citation
The polar T1 interface is linked to conformational changes that open the voltage-gated potassium channel. Minor, D.L., Lin, Y.F., Mobley, B.C. et al. Cell (2000) 102:657-670. DOI 10.1016/S0092-8674(00)00088-X · PubMed
Other PDB entries of the same protein (UniProt P63142 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1DSX 1.6 Å, KV1.2 T1 domain, residues 33-119, T46V mutant
- 1QDV 1.6 Å, N-terminal domain, voltage-gated potassium channel KV1.2 residues 33-131
- 4JTA 2.5 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin
- 4JTD 2.54 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of…
- 8VCH 2.55 Å, Voltage gated potassium ion channel Kv1.2 W366F, C-type inactivated
- 4JTC 2.56 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+
- 2A79 2.9 Å, Mammalian Shaker Kv1.2 potassium channel- beta subunit complex
- 3LNM 2.9 Å, F233W mutant of the Kv2.1 paddle-Kv1.2 chimera channel
- 3LUT 2.9 Å, A Structural Model for the Full-length Shaker Potassium Channel Kv1.2
- 6EBL 3.0 Å, The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic…
- 7SIZ 3.1 Å, C-type inactivation in a voltage gated K+ channel
- 8VC4 3.17 Å, Voltage gated potassium ion channel Kv1.2 in Sodium
Browse structure collections
About this viewer
MolViewer shows 1QDW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.