1QG7: Stroma cell-derived factor-1ALPHA

Name: PDB 1QG7: Stroma cell-derived factor-1ALPHA (sdf-1ALPHA)
Published: 2001-02-28
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cytokine

Stroma cell-derived factor-1ALPHA (sdf-1ALPHA). Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Feb 2001.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,067
Mol. weight: 15.99 kDa
Released: 28 Feb 2001

Explore 1QG7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QG7 contains 5 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
α-helix	20-22	3
β-strand	23-31	9	1
β-strand	35-42	8	1
β-strand	48-51	4	1
α-helix	56-65	10

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	2
α-helix	20-22	3
β-strand	23-29	7	1
β-strand	38-42	5	1
β-strand	48-50	3	1
β-strand	51	1	2
α-helix	56-61	6
α-helix	63-66	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stromal cell-derived factor 1 alpha	A, B	protein	67	Homo sapiens	P48061 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1QG7_1 STROMAL CELL-DERIVED FACTOR 1 ALPHA (chains A, B)
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQE
YLEKALN

Primary citation

Crystal structure of recombinant native SDF-1alpha with additional mutagenesis studies: an attempt at a more comprehensive interpretation of accumulated structure-activity relationship data. Ohnishi, Y., Senda, T., Nandhagopal, N. et al. J Interferon Cytokine Res (2000) 20:691-700. DOI 10.1089/10799900050116390 · PubMed

Other PDB entries of the same protein (UniProt P48061 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GV3 1.6 Å, CXCL12 (SDF) in trigonal space group
6SHR 1.75 Å, X-ray crystal structure of cell-free protein synthesis (CFPS) produced SDF1-a
4UAI 1.9 Å, Crystal structure of CXCL12 in complex with inhibitor
2J7Z 1.95 Å, Crystal Structure of recombinant Human Stromal Cell-Derived Factor- 1alpha
2NWG 2.07 Å, Structure of CXCL12:heparin disaccharide complex
1A15 2.2 Å, Sdf-1ALPHA
3HP3 2.2 Å, Crystal structure of CXCL12
9UPV 2.7 Å, Cryo-EM structure of CXCR4 complexed with agonist SDVX1
4LMQ 2.77 Å, Development and Preclinical Characterization of a Humanized Antibody Targeting CXCL12
9UPU 2.8 Å, Cryo-EM strucutre of CXCR4 complexed with agonist SDV1a
8K3Z 2.81 Å, Cryo-EM structure of CXCR4 in complex with CXCL12
8U4O 3.29 Å, Structure of CXCL12-bound CXCR4/Gi complex

Browse structure collections

About this viewer

MolViewer shows 1QG7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.