1QGT: Human hepatitis B viral capsid

Name: PDB 1QGT: Human hepatitis B viral capsid (HBCAG)
Published: 1999-06-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: virus

Human hepatitis B viral capsid (HBCAG). Determined by X-ray diffraction at 3.3 Å resolution. Released 25 Jun 1999.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Hepatitis B virus
Chains: 4
Atoms: 4,560
Mol. weight: 67.47 kDa
Released: 25 Jun 1999

Explore 1QGT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QGT contains 38 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	13-16	4
α-helix	21-23	3
α-helix	27-43	17
α-helix	50-73	24
α-helix	79-88	10
α-helix	89-93	5
α-helix	94-110	17
α-helix	112-127	16
α-helix	130-132	3
α-helix	137-138	2

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	7-9	3
α-helix	13-17	5
α-helix	21-23	3
α-helix	27-43	17
α-helix	50-73	24
α-helix	79-88	10
α-helix	89-93	5
α-helix	94-126	33

Chain C: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	7-9	3
α-helix	13-17	5
α-helix	21-23	3
α-helix	25-26	2
α-helix	27-43	17
α-helix	50-73	24
α-helix	79-88	10
α-helix	89-93	5
α-helix	94-110	17
α-helix	112-126	15
α-helix	130-132	3

Chain D: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	7-9	3
α-helix	13-16	4
α-helix	21-23	3
α-helix	27-43	17
α-helix	50-72	23
α-helix	79-87	9
α-helix	88-93	6
α-helix	94-110	17
α-helix	112-127	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (HBV capsid protein)	A, B, C, D	protein	149	Hepatitis B virus	Q67855

Sequence of entity 1 (A, B, C, D), FASTA

>1QGT_1 PROTEIN (HBV CAPSID PROTEIN) (chains A, B, C, D)
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIL
CWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
SFGVWIRTPPAYRPPNAPILSTLPETTVV

Primary citation

The crystal structure of the human hepatitis B virus capsid. Wynne, S.A., Crowther, R.A., Leslie, A.G. Mol Cell (1999) 3:771-780. DOI 10.1016/S1097-2765(01)80009-5 · PubMed

Other PDB entries of the same protein (UniProt Q67855), best resolution first:

6TIK 3.4 Å, Hepatitis B virus core shell--virus-like particle with NadA epitope

Browse more

1QGT is part of these collections:

Viruses

About this viewer

MolViewer shows 1QGT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.