1QLX: Human prion protein

Name: PDB 1QLX: Human prion protein
Published: 1999-12-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: prion protein

Human prion protein. Determined by solution NMR. Released 16 Dec 1999.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 877
Mol. weight: 22.92 kDa
Released: 16 Dec 1999

Explore 1QLX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QLX contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	129-130	2	1
α-helix	144-153	10
β-strand	162-163	2	1
α-helix	173-186	14
α-helix	187-191	5
α-helix	192-194	3
α-helix	200-227	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prion protein	A	protein	210	HOMO SAPIENS	P04156 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QLX_1 PRION PROTEIN (chains A)
GSKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGG
WGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIH
FGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTE
TDVKMMERVVEQMCITQYERESQAYYQRGS

Primary citation

NMR Solution Structure of the Human Prion Protein. Zahn, R., Liu, A., Luhrs, T. et al. Proc Natl Acad Sci U S A (2000) 97:145. DOI 10.1073/PNAS.97.1.145 · PubMed

Other PDB entries of the same protein (UniProt P04156 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OL9 0.85 Å, Peptide corresponding to residues 170-175 of human prion
7RVE 0.85 Å, Segment from the S170N mutant of the human prion protein 168-176 EYNNQNNFV
7RVJ 1.0 Å, Segment from the human prion protein 169-175 YSNQNNF
7RVK 1.0 Å, Segment from Y169G mutant of the human prion protein 169-175 GSNQNNF
7RVL 1.0 Å, Segment from the Y169F mutant of the human prion protein 168-176 EFSNQNNFV
7RVC 1.0 Å, Segment from the human prion protein 168-176 EYSNQNNFV
3MD4 1.15 Å, Prion peptide
3MD5 1.4 Å, Prion peptide
4E1H 1.4 Å, Fragment of human prion protein
6PQA 1.46 Å, GAVVGG segment 119-124 from human prion
4KML 1.5 Å, Probing the N-terminal beta-sheet conversion in the crystal structure of the full-length…
4N9O 1.5 Å, Probing the N-terminal beta-sheet conversion in the crystal structure of the human prion…

Browse more

1QLX is part of these collections:

Protein folding, misfolding and amyloid

About this viewer

MolViewer shows 1QLX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.