1QNT: Human O6alkylguanine-DNA alkyltransferase

X-ray structure of human O6alkylguanine-DNA alkyltransferase. Determined by X-ray diffraction at 1.9 Å resolution. Released 16 Dec 1999.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,438
Mol. weight: 18.95 kDa
Released: 16 Dec 1999

Explore 1QNT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QNT contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	19-24	6	1
β-strand	27-33	7	1
α-helix	57-71	15
α-helix	73-78	6
α-helix	80-83	4
β-strand	84	1	1
α-helix	87-90	4
α-helix	94-105	12
β-strand	112-113	2	2
α-helix	114-120	7
α-helix	127-134	8
β-strand	140	1	3
β-strand	143	1	3
α-helix	145-147	3
β-strand	148-149	2	2
α-helix	162-171	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Methylated-DNA--protein-cysteine methyltransferase	A	protein	176	HOMO SAPIENS	P16455 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QNT_1 METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE (chains A)
MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM
QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL
AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL

Primary citation

Crystal Structure of the Human O(6)-Alkylguanine-DNA Alkyltransferase. Wibley, J.E.A., Pegg, A.E., Moody, P.C.E. Nucleic Acids Res (2000) 28:393. DOI 10.1093/NAR/28.2.393 · PubMed

Other PDB entries of the same protein (UniProt P16455 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EH6 2.0 Å, Human O6-alkylguanine-DNA alkyltransferase
1EH7 2.0 Å, Methylated human O6-alkylguanine-DNA alkyltransferase
9QF2 2.42 Å, Cryo-EM structure of the fully Coronin-1B-decorated actin filament in the ADP state.
1EH8 2.5 Å, Benzylated human O6-alkylguanine-DNA alkyltransferase
28OP 2.7 Å, Structure of the human inner kinetochore CCAN and CENP-C bound to DNA
9QEY 2.74 Å, Cryo-EM structure of the actin filament bound by a single Coronin-1B molecule.
9QFB 2.74 Å, Cryo-EM structure of the fully Coronin-1B-decorated actin filament in the ADP state.
9QFQ 2.76 Å, Cryo-EM structure of the cofilactin barbed end bound by AIP1
1YFH 3.01 Å, wt Human O6-Alkylguanine-DNA Alkyltransferase Bound To DNA Containing an Alkylated…
9DI0 3.1 Å, Cryo-EM structure of Kif18A bound to a microtubule
9QFE 3.12 Å, Cryo-EM structure of the actin filament hetero-decorated by Coronin-1 and Cofilin-1 on…
9QFW 3.16 Å, Cryo-EM structure of the cofilactin barbed end bound by two AIP1 molecules

Browse structure collections

About this viewer

MolViewer shows 1QNT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.