D199S mutant of bovine 70 kilodalton heat shock protein. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Sept 1999.
Explore 1QQM in 3D Show helices and sheets RCSB PDB PDBe
1QQM contains 16 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-10 | 4 | 1 |
| β-strand | 15-16 | 2 | 2 |
| β-strand | 17-22 | 6 | 1 |
| β-strand | 25-28 | 4 | 1 |
| β-strand | 38-39 | 2 | 2 |
| β-strand | 42-44 | 3 | 3 |
| β-strand | 49-51 | 3 | 3 |
| α-helix | 53-56 | 4 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-67 | 2 | 3 |
| α-helix | 70-72 | 3 | |
| α-helix | 81-87 | 7 | |
| β-strand | 93-97 | 5 | 4 |
| β-strand | 100-107 | 8 | 4 |
| β-strand | 110-114 | 5 | 4 |
| α-helix | 116-135 | 20 | |
| β-strand | 141-146 | 6 | 1 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 1 |
| α-helix | 175-182 | 8 | |
| β-strand | 193-200 | 8 | 5 |
| β-strand | 205-213 | 9 | 5 |
| β-strand | 216-225 | 10 | 5 |
| α-helix | 230-249 | 20 | |
| α-helix | 257-273 | 17 | |
| β-strand | 279-288 | 10 | 6 |
| β-strand | 291-298 | 8 | 6 |
| α-helix | 299-311 | 13 | |
| α-helix | 314-324 | 11 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 5 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| α-helix | 357-359 | 3 | |
| β-strand | 360 | 1 | 5 |
| α-helix | 368-380 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| D199S mutant of bovine 70 kilodalton heat shock protein | A | protein | 378 | Bos taurus | P19120 (AlphaFold model) |
>1QQM_1 D199S MUTANT OF BOVINE 70 KILODALTON HEAT SHOCK PROTEIN (chains A) GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP TNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGAPKVQVEYKGETKSFYPEEVSSMV LTKMKEIAEAYLGATVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAY GLDKAVGAERNVLIFSLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIA EFKRAHAKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFE ELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSI NPDEAVAYGAAVQAAILS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
| PO4 | Phosphate ion | O4 P | 1 |
| MG | Magnesium ion | Mg | 1 |
Water and common crystallization additives (CL, K) are not listed.
Mapping the role of active site residues for transducing an ATP-induced conformational change in the bovine 70-kDa heat shock cognate protein. Johnson, E.R., McKay, D.B. Biochemistry (1999) 38:10823-10930. DOI 10.1021/bi990816g · PubMed
Other PDB entries of the same protein (UniProt P19120 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1QQM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.