1QS7: Calmodulin

The 1.8 angstrom structure of calmodulin rs20 peptide complex. Determined by X-ray diffraction at 1.8 Å resolution. Released 24 Jun 2003.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Escherichia coli
Chains: 4
Atoms: 2,859
Mol. weight: 37.63 kDa
Ligands: CA
Released: 24 Jun 2003

Explore 1QS7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QS7 contains 19 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	1
α-helix	29-39	11
α-helix	45-55	11
β-strand	63-64	2	1
α-helix	65-73	9
α-helix	74-77	4
α-helix	78-92	15
β-strand	100	1	2
α-helix	102-112	11
α-helix	118-128	11
β-strand	136	1	2
α-helix	138-146	9

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-18	16

Chain C: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	3
α-helix	29-38	10
α-helix	45-55	11
β-strand	63-64	2	3
α-helix	65-73	9
α-helix	78-92	15
β-strand	99-100	2	4
α-helix	102-112	11
α-helix	118-128	11
β-strand	136-137	2	4
α-helix	138-145	8

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-18	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A, C	protein	145	Escherichia coli	A0MMD0 (AlphaFold model)
RS20	B, D	protein	21		P11799 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1QS7_1 CALMODULIN (chains A, C)
LTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI
DFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDE
MIREADVDGDGQVNYEEFVQVMMAK

Sequence of entity 2 (B, D), FASTA

>1QS7_2 RS20 (chains B, D)
RRKWQKTGHAVRAIGRLSSSX

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	8

Primary citation

High Resolution Structure of a Calmodulin Rs20 Peptide Complex. Weigand, S., Shuvalova, L., Lukas, T.J. et al. To be published.

Other PDB entries of the same protein (UniProt A0MMD0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QTX 1.65 Å, The 1.65 Å structure of calmodulin RS20 peptide complex

Browse structure collections

About this viewer

MolViewer shows 1QS7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.