1QSC: Tnf receptor associated factor 2

Crystal structure of the traf domain of TRAF2 in a complex with a peptide from the CD40 receptor. Determined by X-ray diffraction at 2.4 Å resolution. Released 1 Aug 1999.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 6
Atoms: 4,589
Mol. weight: 68.09 kDa
Released: 1 Aug 1999

Explore 1QSC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QSC contains 24 α-helices and 36 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	324-345	22
β-strand	353-359	7	1
α-helix	361-369	9
β-strand	376-377	2	2
α-helix	378-380	3
β-strand	381-382	2	2
β-strand	389-395	7	2
α-helix	400-402	3
β-strand	406-414	9	2
α-helix	419-421	3
β-strand	430-434	5	1
β-strand	443-447	5	1
α-helix	454-456	3
α-helix	458-459	2
β-strand	463	1	2
α-helix	464-466	3
β-strand	467-474	8	2
β-strand	486	1	1
β-strand	489-496	8	1

Chains B and C: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	324-347	24
β-strand	353-359	7	3
α-helix	361-369	9
β-strand	376-377	2	4
α-helix	378-380	3
β-strand	381-382	2	4
β-strand	389-395	7	4
α-helix	400-402	3
β-strand	406-414	9	4
α-helix	419-421	3
β-strand	430-434	5	3
β-strand	443-447	5	3
α-helix	454-456	3
α-helix	458-459	2
β-strand	463	1	4
α-helix	464-466	3
β-strand	467-474	8	4
β-strand	486	1	3
β-strand	489-496	8	3

Chains D, E and F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	251-252	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tnf receptor associated factor 2	A, B, C	protein	191	Homo sapiens	Q12933 (AlphaFold model)
CD40 receptor	D, E, F	protein	7

Sequence of entity 1 (A, B, C), FASTA

>1QSC_1 TNF RECEPTOR ASSOCIATED FACTOR 2 (chains A, B, C)
QDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVA
GRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKV
TLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAI
FIKAIVDLTGL

Sequence of entity 2 (D, E, F), FASTA

>1QSC_2 CD40 RECEPTOR (chains D, E, F)
XYPIQET

Primary citation

Crystallographic analysis of CD40 recognition and signaling by human TRAF2. McWhirter, S.M., Pullen, S.S., Holton, J.M. et al. Proc Natl Acad Sci U S A (1999) 96:8408-8413. DOI 10.1073/pnas.96.15.8408 · PubMed

Other PDB entries of the same protein (UniProt Q12933 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KNV 1.9 Å, Crystal structure of the RING and first zinc finger domains of TRAF2
8T5Q 1.9 Å, SARS-CoV-2 ORF3a peptide in complex with TRAF2 TRAF domain
1CZY 2.0 Å, Crystal structure of the complex between the traf domain of human TRAF2 and an LMP1…
1D00 2.0 Å, Structure of tnf receptor associated factor 2 in complex with a 5-residue CD40 peptide
1D01 2.0 Å, Structure of tnf receptor associated factor 2 in complex with a human CD30 peptide
1D0A 2.0 Å, Structure of tnf receptor associated factor 2 (TRAF2) in complex with a human OX40 peptide
1F3V 2.0 Å, Crystal structure of the complex between the N-terminal domain of TRADD and the TRAF…
1CA4 2.2 Å, Structure of tnf receptor associated factor 2 (TRAF2)
1CA9 2.3 Å, Structure of tnf receptor associated factor 2 in complex with a peptide from tnf-R2
1D0J 2.5 Å, Structure of tnf receptor associated factor 2 in complex with a M4-1BB peptide
3M0A 2.61 Å, Crystal structure of TRAF2:cIAP2 complex
3M06 2.67 Å, Crystal Structure of TRAF2

Browse structure collections

About this viewer

MolViewer shows 1QSC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.