1QSV: Vascular endothelial growth factor receptor 1

The vegf-binding domain of flt-1, 20 NMR structures. Determined by solution NMR. Released 10 Nov 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 810
Mol. weight: 11.54 kDa
Released: 10 Nov 1999

Explore 1QSV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QSV contains 3 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	135	1	1
α-helix	143	1
β-strand	144-148	5	2
β-strand	154-156	3	3
β-strand	160	1	1
α-helix	163-165	3
β-strand	168-171	4	2
β-strand	175-176	2	2
β-strand	184-187	4	3
β-strand	191-194	4	3
α-helix	199-201	3
β-strand	204-210	7	2
β-strand	215-224	10	2
β-strand	226	1	4
β-strand	228	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vascular endothelial growth factor receptor 1	A	protein	101	Homo sapiens	P17948 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QSV_1 VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 1 (chains A)
SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDS
RKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTI

Primary citation

Solution structure of the VEGF-binding domain of Flt-1: comparison of its free and bound states. Starovasnik, M.A., Christinger, H.W., Wiesmann, C. et al. J Mol Biol (1999) 293:531-544. DOI 10.1006/jmbi.1999.3134 · PubMed

Other PDB entries of the same protein (UniProt P17948 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FLT 1.7 Å, Vegf in complex with domain 2 of the flt-1 receptor
5ABD 2.0 Å, Crystal structure of vegfr-1 domain 2 in presence of CU
4CL7 2.0 Å, Crystal structure of VEGFR-1 domain 2 in presence of Cobalt
4CKV 2.06 Å, Crystal structure of VEGFR-1 domain 2 in presence of Zn
5EX3 2.41 Å, Crystal structure of human SMYD3 in complex with a VEGFR1 peptide
1RV6 2.45 Å, Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1
1QTY 2.7 Å, Vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor
3HNG 2.7 Å, Crystal structure of VEGFR1 in complex with N-(4-Chlorophenyl)-2-((pyridin-4-ylmethyl)ami…
2XAC 2.71 Å, Structural Insights into the Binding of VEGF-B by VEGFR-1D2: Recognition and Specificity
5T89 4.0 Å, Crystal structure of VEGF-A in complex with VEGFR-1 domains D1-6
1QSZ The vegf-binding domain of flt-1 (minimized mean)

Browse structure collections

About this viewer

MolViewer shows 1QSV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.