The vegf-binding domain of flt-1 (minimized mean). Determined by solution NMR. Released 10 Nov 1999.
Explore 1QSZ in 3D Show helices and sheets RCSB PDB PDBe
1QSZ contains 3 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 135 | 1 | 1 |
| α-helix | 143 | 1 | |
| β-strand | 144-148 | 5 | 2 |
| β-strand | 154-156 | 3 | 3 |
| β-strand | 160 | 1 | 1 |
| α-helix | 163-165 | 3 | |
| β-strand | 168-171 | 4 | 2 |
| β-strand | 175-176 | 2 | 2 |
| β-strand | 184-187 | 4 | 3 |
| β-strand | 191-194 | 4 | 3 |
| α-helix | 199-201 | 3 | |
| β-strand | 204-210 | 7 | 2 |
| β-strand | 215-224 | 10 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Vascular endothelial growth factor receptor 1 | A | protein | 101 | Homo sapiens | P17948 (AlphaFold model) |
>1QSZ_1 VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 1 (chains A) SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDS RKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTI
Solution structure of the VEGF-binding domain of Flt-1: comparison of its free and bound states. Starovasnik, M.A., Christinger, H.W., Wiesmann, C. et al. J Mol Biol (1999) 293:531-544. DOI 10.1006/jmbi.1999.3134 · PubMed
Other PDB entries of the same protein (UniProt P17948 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1QSZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.