1QU1: EHA2

Crystal structure of EHA2 (23-185). Determined by X-ray diffraction at 1.9 Å resolution. Released 5 Jan 2000.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Influenza A virus
Chains: 6
Atoms: 7,907
Mol. weight: 108.37 kDa
Released: 5 Jan 2000

Explore 1QU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QU1 contains 34 α-helices and 17 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	38-104	67
α-helix	113-125	13
α-helix	146-154	9
α-helix	164-171	8

Chain B: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	35	1	1
α-helix	38-104	67
α-helix	113-129	17
β-strand	130-134	5	2
β-strand	137-140	4	2
α-helix	148-154	7
α-helix	164-171	8

Chain C: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	37	1	1
α-helix	38-41	4
α-helix	43-104	62
α-helix	113-128	16
α-helix	146-154	9
α-helix	165-170	6

Chain D: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	34	1
β-strand	35-36	2	3
β-strand	37	1	4
α-helix	38-104	67
α-helix	113-125	13
α-helix	130-135	6
α-helix	146-154	9
α-helix	164-171	8
α-helix	173-174	2
β-strand	175-176	2	3

Chain E: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	34	1
β-strand	35	1	5
β-strand	36	1	6
β-strand	37	1	3
α-helix	38-104	67
α-helix	113-130	18
α-helix	148-153	6
α-helix	164-171	8
α-helix	173-174	2
β-strand	175	1	6
α-helix	176	1

Chain F: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	34	1
β-strand	35	1	4
β-strand	36	1	7
β-strand	37	1	5
α-helix	38-104	67
α-helix	113-129	17
β-strand	131	1	8
β-strand	139	1	8
α-helix	146-154	9
α-helix	164-170	7
α-helix	173-174	2
β-strand	175	1	7
α-helix	176	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (influenza recombinant HA2 chain)	A, B, C, D, E, F	protein	155	Influenza A virus	P03437

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>1QU1_1 PROTEIN (INFLUENZA RECOMBINANT HA2 CHAIN) (chains A, B, C, D, E, F)
GTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKID
LWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGSFKIYHKCDNACIE
SIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDW

Primary citation

N- and C-terminal residues combine in the fusion-pH influenza hemagglutinin HA(2) subunit to form an N cap that terminates the triple-stranded coiled coil. Chen, J., Skehel, J.J., Wiley, D.C. Proc Natl Acad Sci U S A (1999) 96:8967-8972. DOI 10.1073/pnas.96.16.8967 · PubMed

Other PDB entries of the same protein (UniProt P03437), best resolution first:

8PJF 1.48 Å, Human Leukocyte Antigen class II allotype DR1 presenting P11T->R modified influenza A…
8PJE 1.7 Å, Human Leukocyte Antigen class II allotype DR1 presenting influenza A virus…
8PJG 1.83 Å, F11 TCR in complex with Human Leukocyte Antigen class II allotype DR1 presenting P11T->R…
6E56 2.0 Å, Human antibody H2214 in complex with influenza hemagglutinin A/Aichi/2/1968 (X-31) (H3N2)
1PYW 2.1 Å, Human class II MHC protein HLA-DR1 bound to a designed peptide related to influenza…
3S5L 2.1 Å, Crystal structure of CD4 mutant bound to HLA-DR1
1J8H 2.4 Å, Crystal Structure of a Complex of a Human alpha/beta-T cell Receptor, Influenza HA…
3S4S 2.4 Å, Crystal structure of CD4 mutant bound to HLA-DR1
1HTM 2.5 Å, Structure of influenza haemagglutinin at the PH of membrane fusion
2VIU 2.5 Å, Influenza virus hemagglutinin
6XPX 2.6 Å, Human antibody S1V2-51 in complex with the influenza hemagglutinin head domain of…
1FYT 2.6 Å, Crystal structure of a complex of a human alpha/beta-T cell receptor, influenza ha…

Browse structure collections

About this viewer

MolViewer shows 1QU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.