1QZW: Signal recognition 54 kDa protein

Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication. Determined by X-ray diffraction at 4.1 Å resolution. Released 18 Nov 2003.

Method: X-ray diffraction
Resolution: 4.1 Å
Organism: Sulfolobus solfataricus
Chains: 8
Atoms: 17,720
Mol. weight: 260.07 kDa
Released: 18 Nov 2003

Explore 1QZW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QZW contains 80 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C, E and G: 20 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-12	5
α-helix	21-35	15
α-helix	42-55	14
α-helix	66-81	16
β-strand	98-102	5	1
α-helix	113-121	9
β-strand	129	1	1
α-helix	140-149	10
α-helix	165-176	12
β-strand	182-186	5	1
α-helix	195-209	15
β-strand	213-219	7	1
α-helix	223-226	4
α-helix	227-234	8
β-strand	241-245	5	1
α-helix	255-261	7
β-strand	267	1	1
α-helix	285-290	6
α-helix	298-307	10
α-helix	331-341	11
α-helix	347-351	5
α-helix	374-377	4
α-helix	387-390	4
α-helix	398-406	9
α-helix	411-413	3
α-helix	415-428	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
7S RNA	B, D, F, H	RNA	47	Sulfolobus solfataricus
Signal recognition 54 kDa protein	A, C, E, G	protein	440	Sulfolobus solfataricus	Q97ZE7 (AlphaFold model)

Sequence of entity 1 (B, D, F, H), FASTA

>1QZW_1 7S RNA (chains B, D, F, H)
GGCCGGGGGAACCGGCCAGGCCCGGAAGGGAGCAACCGUGCCCGGUC

Sequence of entity 2 (A, C, E, G), FASTA

>1QZW_2 Signal recognition 54 kDa protein (chains A, C, E, G)
MGHHHHHHMLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIK
ERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTT
AGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVD
IFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASR
FHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRIL
GMGDIESILEKVKGLEEYDKIQKKMEDVMEGKGKLTLRDVYAQIIALRKMGPLSKVLQHI
PGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVE
EVRELLEWYNNMNRLLKMVK

Primary citation

Crystal structure of the complete core of archaeal signal recognition particle and implications for interdomain communication. Rosendal, K.R., Wild, K., Montoya, G. et al. Proc Natl Acad Sci U S A (2003) 100:14701-14706. DOI 10.1073/pnas.2436132100 · PubMed

Other PDB entries of the same protein (UniProt Q97ZE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5L3S 1.9 Å, Structure of the GTPase heterodimer of crenarchaeal SRP54 and FtsY
5L3V 2.3 Å, Structure of the crenarchaeal SRP54 GTPase bound to GDP
3KL4 3.5 Å, Recognition of a signal peptide by the signal recognition particle
1QZX 4.0 Å, Crystal structure of the complete core of archaeal SRP and implications for inter-domain…
3ZN8 12.0 Å, Structural Basis of Signal Sequence Surveillance and Selection by the SRP-SR Complex
2IY3 16.0 Å, Structure of the E. Coli Signal Regognition Particle

Browse structure collections

About this viewer

MolViewer shows 1QZW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.