1QZX: Signal recognition 54 kDa protein

Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication. Determined by X-ray diffraction at 4.0 Å resolution. Released 18 Nov 2003.

Method: X-ray diffraction
Resolution: 4.0 Å
Organism: Sulfolobus solfataricus
Chains: 2
Atoms: 6,698
Mol. weight: 98.93 kDa
Released: 18 Nov 2003

Explore 1QZX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QZX contains 48 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 24 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12
α-helix	19-36	18
α-helix	41-47	7
α-helix	50-57	8
α-helix	59-61	3
α-helix	66-81	16
β-strand	97-102	6	1
α-helix	112-122	11
β-strand	127-131	5	1
α-helix	138-149	12
β-strand	153-155	3	1
α-helix	163-176	14
β-strand	181-185	5	1
α-helix	195-209	15
β-strand	213-219	7	1
α-helix	220-225	6
α-helix	226-235	10
β-strand	240-245	6	1
α-helix	247-249	3
α-helix	253-262	10
β-strand	267-271	5	1
β-strand	279-281	3	1
α-helix	284-289	6
α-helix	294-318	25
α-helix	333-341	9
α-helix	346-349	4
α-helix	374-377	4
α-helix	379-382	4
β-strand	385	1	2
α-helix	386-390	5
α-helix	392-394	3
α-helix	397-407	11
α-helix	411-430	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition 54 kDa protein	A, B	protein	440	Sulfolobus solfataricus	Q97ZE7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1QZX_1 Signal recognition 54 kDa protein (chains A, B)
MGHHHHHHMLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIK
ERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTT
AGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVD
IFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASR
FHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRIL
GMGDIESILEKVKGLEEYDKIQKKMEDVMEGKGKLTLRDVYAQIIALRKMGPLSKVLQHI
PGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVE
EVRELLEWYNNMNRLLKMVK

Primary citation

Crystal structure of the complete core of archaeal signal recognition particle and implications for interdomain communication. Rosendal, K.R., Wild, K., Montoya, G. et al. Proc Natl Acad Sci U S A (2003) 100:14701-14706. DOI 10.1073/pnas.2436132100 · PubMed

Other PDB entries of the same protein (UniProt Q97ZE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5L3S 1.9 Å, Structure of the GTPase heterodimer of crenarchaeal SRP54 and FtsY
5L3V 2.3 Å, Structure of the crenarchaeal SRP54 GTPase bound to GDP
3KL4 3.5 Å, Recognition of a signal peptide by the signal recognition particle
1QZW 4.1 Å, Crystal structure of the complete core of archaeal SRP and implications for inter-domain…
3ZN8 12.0 Å, Structural Basis of Signal Sequence Surveillance and Selection by the SRP-SR Complex
2IY3 16.0 Å, Structure of the E. Coli Signal Regognition Particle

Browse structure collections

About this viewer

MolViewer shows 1QZX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.