mercury-substituted rubredoxin. Determined by X-ray diffraction at 1.6 Å resolution. Released 10 Feb 2004.
Explore 1R0G in 3D Show helices and sheets RCSB PDB PDBe
1R0G contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 1 |
| β-strand | 12-13 | 2 | 1 |
| β-strand | 19 | 1 | 2 |
| α-helix | 20-22 | 3 | |
| β-strand | 24 | 1 | 2 |
| α-helix | 30-32 | 3 | |
| β-strand | 38 | 1 | 3 |
| β-strand | 45 | 1 | 3 |
| α-helix | 46-48 | 3 | |
| β-strand | 49-51 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rubredoxin | A | protein | 54 | Clostridium pasteurianum | P00268 (AlphaFold model) |
>1R0G_1 Rubredoxin (chains A) MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE
| ID | Name | Formula | Copies |
|---|---|---|---|
| HG | Mercury (II) ion | Hg | 1 |
Metal-substituted derivatives of the rubredoxin from Clostridium pasteurianum. Maher, M., Cross, M., Wilce, M.C. et al. Acta Crystallogr D Biol Crystallogr (2004) 60:298-303. DOI 10.1107/S090744490302794X · PubMed
Other PDB entries of the same protein (UniProt P00268 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1R0G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.