Crystal Structure of Cp Rd L41A mutant in reduced state 1 (drop-reduced). Determined by X-ray diffraction at 1.43 Å resolution. Released 16 Mar 2004.
Explore 1SMU in 3D Show helices and sheets RCSB PDB PDBe
1SMU contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 1 |
| β-strand | 12-13 | 2 | 1 |
| β-strand | 19 | 1 | 2 |
| α-helix | 20-22 | 3 | |
| β-strand | 24 | 1 | 2 |
| α-helix | 30-32 | 3 | |
| β-strand | 38 | 1 | 3 |
| β-strand | 45 | 1 | 3 |
| α-helix | 46-48 | 3 | |
| β-strand | 49-51 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rubredoxin | A | protein | 54 | Clostridium pasteurianum | P00268 (AlphaFold model) |
>1SMU_1 Rubredoxin (chains A) MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPACGVGKDQFEEVEE
| ID | Name | Formula | Copies |
|---|---|---|---|
| FE2 | FE (II) ion | Fe | 1 |
The unique hydrogen bonded water in the reduced form of Clostridium pasteurianum rubredoxin and its possible role in electron transfer. Park, I.Y., Youn, B., Harley, J.L. et al. J Biol Inorg Chem (2004) 9:423-428. DOI 10.1007/s00775-004-0542-3 · PubMed
Other PDB entries of the same protein (UniProt P00268 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1SMU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.