1R8U: CBP TAZ1/CITED2 complex

NMR structure of CBP TAZ1/CITED2 complex. Determined by solution NMR. Released 23 Mar 2004.

Method: Solution NMR
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 1,195
Mol. weight: 17.38 kDa
Ligands: ZN
Released: 23 Mar 2004

Explore 1R8U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1R8U contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	225-235	11
α-helix	237-239	3
α-helix	243-245	3
α-helix	251-253	3
α-helix	266-268	3

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	348-371	24
α-helix	384-394	11
α-helix	406-421	16
α-helix	429-435	7
α-helix	436-438	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cbp/p300-interacting transactivator 2	A	protein	50	Homo sapiens	Q99967 (AlphaFold model)
CREB-binding protein	B	protein	100	Mus musculus	P45481 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1R8U_1 Cbp/p300-interacting transactivator 2 (chains A)
TDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVS

Sequence of entity 2 (B), FASTA

>1R8U_2 CREB-binding protein (chains B)
ATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQA
GKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Interaction of the TAZ1 domain of the CREB-binding protein with the activation domain of CITED2: regulation by competition between intrinsically unstructured ligands for non-identical binding sites. De Guzman, R.N., Martinez-Yamout, M.A., Dyson, H.J. et al. J Biol Chem (2004) 279:3042-3049. DOI 10.1074/jbc.M310348200 · PubMed

Other PDB entries of the same protein (UniProt Q99967 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QGS 2.0 Å, Crystal structure of p300 CH1 domain in complex with CITIF (a CITED2-HIF-1alpha hybrid)
7LVS 2.02 Å, The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide
1P4Q Solution structure of the CITED2 transactivation domain in complex with the p300 CH1…

Browse structure collections

About this viewer

MolViewer shows 1R8U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.