7QGS: P300 CH1 domain

Crystal structure of p300 CH1 domain in complex with CITIF (a CITED2-HIF-1alpha hybrid). Determined by X-ray diffraction at 2.0 Å resolution. Released 11 May 2022.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,210
Mol. weight: 17.49 kDa
Ligands: ZN
Released: 11 May 2022

Explore 7QGS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QGS contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	332-357	26
α-helix	369-381	13
α-helix	385-387	3
α-helix	393-405	13
α-helix	415-418	4

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	6-15	10
α-helix	29-35	7
α-helix	49-53	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha	B	protein	58	Homo sapiens	Q16665 (AlphaFold model), Q99967 (AlphaFold model)
Histone acetyltransferase	A	protein	96	Homo sapiens	Q09472 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7QGS_1 Cbp/p300-interacting transactivator 2,Hypoxia-inducible factor 1-alpha (chains B)
GPGSDEEVLMSLVIEMGLDRIKELPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN

Sequence of entity 2 (A), FASTA

>7QGS_2 Histone acetyltransferase (chains A)
GPIGSADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQS
GKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Understanding p300-transcription factor interactions using sequence variation and hybridization. Hobor, F., Hegedus, Z., Ibarra, A.A. et al. RSC Chem Biol (2022) 3:592-603. DOI 10.1039/d2cb00026a · PubMed

Other PDB entries of the same protein (UniProt Q16665 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4H6J 1.52 Å, Identification of Cys 255 in HIF-1 as a novel site for development of covalent…
4AJY 1.73 Å, von Hippel-Lindau protein-ElonginB-ElonginC complex, bound to Hif1- alpha peptide
6GMR 1.75 Å, pVHL:EloB:EloC in complex with (4-(1H-pyrrol-1-yl)phenyl)methanol
8HE0 1.8 Å, Crystal structure of importin-alpha1 bound to the HIF-1alpha nuclear localization signal…
5L9V 1.83 Å, HIF prolyl hydroxylase 2 (PHD2-R281C/P317C) cross-linked to HIF-1alpha NODD-L397C/D412C…
6GFX 1.83 Å, pVHL:EloB:EloC in complex with modified HIF-1a CODD peptide containing…
1LM8 1.85 Å, Structure of a HIF-1a-pVHL-ElonginB-ElonginC Complex
8HE3 1.9 Å, Crystal structure of importin-alpha1 bound to the HIF-1alpha nuclear localization signal…
5L9B 1.95 Å, Hif prolyl hydroxylase 2 (PHD2/ EGLN1) in complex with 2-oxoglutarate (2OG) and…
1LQB 2.0 Å, Crystal structure of a hydroxylated HIF-1 alpha peptide bound to the…
3HQR 2.0 Å, PHD2:Mn:NOG:HIF1-alpha substrate complex
7LVS 2.02 Å, The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide

Browse structure collections

About this viewer

MolViewer shows 7QGS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.