1RA7: Poliovirus Polymerase with GTP

Poliovirus Polymerase with GTP. Determined by X-ray diffraction at 2.35 Å resolution. Released 17 Aug 2004.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Human poliovirus 1
Chains: 1
Atoms: 4,030
Mol. weight: 53.93 kDa
Ligands: GTP
Released: 17 Aug 2004

Explore 1RA7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RA7 contains 31 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
α-helix	15-18	4
β-strand	26-27	2	2
β-strand	39-40	2	3
α-helix	41-42	2
α-helix	54-59	6
α-helix	72-86	15
α-helix	94-96	3
α-helix	97-102	6
β-strand	104	1	4
β-strand	107	1	4
α-helix	108-111	4
α-helix	120-123	4
α-helix	127-130	4
α-helix	139-148	10
β-strand	154-158	5	1
β-strand	162-163	2	3
α-helix	165-169	5
β-strand	175-178	4	1
α-helix	179-180	2
α-helix	181-199	19
β-strand	203	1	5
β-strand	208	1	5
α-helix	214-217	4
α-helix	221-224	4
β-strand	228-230	3	5
β-strand	233-234	2	6
α-helix	237-240	4
α-helix	243-253	11
α-helix	254-258	5
α-helix	259-261	3
α-helix	263-269	7
β-strand	270-275	6	1
β-strand	278-283	6	1
β-strand	289	1	1
α-helix	293-312	20
α-helix	318-320	3
β-strand	322-326	5	5
β-strand	329-334	6	5
α-helix	340-349	10
β-strand	354-355	2	6
α-helix	357-359	3
β-strand	366	1	5
β-strand	373	1	7
β-strand	376	1	7
β-strand	377-380	4	8
β-strand	388-391	4	8
α-helix	394-401	8
β-strand	403-404	2	2
α-helix	407-409	3
α-helix	410-421	12
α-helix	422-424	3
α-helix	426-436	11
α-helix	440-443	4
α-helix	450-460	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Genome polyprotein	A	protein	461	Human poliovirus 1	P03300 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RA7_1 Genome polyprotein (chains A)
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFS
KYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPY
VAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASS
LNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDAS
LSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMI
NNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKS
ATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLL
AWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1

Water and common crystallization additives (ACY) are not listed.

Primary citation

Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase. Thompson, A.A., Peersen, O.B. EMBO J (2004) 23:3462-3471. DOI 10.1038/sj.emboj.7600357 · PubMed

Other PDB entries of the same protein (UniProt P03300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DCD 1.69 Å, 1.6A resolution structure of PolioVirus 3C Protease Containing a covalently bound…
9U04 1.7 Å, LX-2D6 (Fab) - Polio 1 (VLP) complex
1RA6 2.0 Å, Poliovirus Polymerase Full Length Apo Structure
4NLR 2.0 Å, Poliovirus Polymerase - C290S Loop Mutant
4NLS 2.0 Å, Poliovirus Polymerase - S288A Loop Mutant
1L1N 2.1 Å, Poliovirus 3C proteinase
4NLU 2.1 Å, Poliovirus Polymerase - G289A Loop Mutant
4NLW 2.1 Å, Poliovirus Polymerase - G289A/C290I Loop Mutant
1HXS 2.2 Å, Crystal structure of mahoney strain of poliovirus at 2.2A resolution
4NLO 2.2 Å, Poliovirus Polymerase - C290I Loop Mutant
4NLP 2.2 Å, Poliovirus Polymerase - C290V Loop Mutant
2IM0 2.25 Å, Crystal structure of poliovirus polymerase complexed with CTP and Mg2+

Browse structure collections

About this viewer

MolViewer shows 1RA7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.