1RDR: Poliovirus 3D polymerase

Poliovirus 3D polymerase. Determined by X-ray diffraction at 2.4 Å resolution. Released 16 Sept 1998.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Human poliovirus 1
Chains: 1
Atoms: 2,642
Mol. weight: 52.69 kDa
Ligands: CA
Released: 16 Sept 1998

Explore 1RDR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RDR contains 19 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	22-24	3
β-strand	26-27	2	1
α-helix	72-86	15
α-helix	187-190	4
α-helix	192-200	9
β-strand	203	1	2
β-strand	208	1	2
α-helix	214-217	4
α-helix	221-224	4
β-strand	228-231	4	2
β-strand	233-234	2	3
α-helix	237-240	4
α-helix	243-253	11
α-helix	254-258	5
α-helix	262-265	4
α-helix	293-312	20
α-helix	318-320	3
β-strand	324-326	3	2
β-strand	329-334	6	2
α-helix	340-349	10
β-strand	354-355	2	3
β-strand	373	1	4
β-strand	376	1	4
β-strand	377-380	4	5
β-strand	388-391	4	5
α-helix	394-401	8
β-strand	403-404	2	1
α-helix	410-421	12
α-helix	422-424	3
α-helix	426-436	11
α-helix	440-443	4
α-helix	450-460	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Poliovirus 3D polymerase	A	protein	461	Human poliovirus 1	P03300 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RDR_1 POLIOVIRUS 3D POLYMERASE (chains A)
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFS
KYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPY
VAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASS
LNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDAS
LSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMI
NNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKS
ATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLL
AWHNGEEEYNKFLAKIRSVPIGRALLLPEYSTLYRRWLDSF

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Structure of the RNA-dependent RNA polymerase of poliovirus. Hansen, J.L., Long, A.M., Schultz, S.C. Structure (1997) 5:1109-1122. DOI 10.1016/S0969-2126(97)00261-X · PubMed

Other PDB entries of the same protein (UniProt P03300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DCD 1.69 Å, 1.6A resolution structure of PolioVirus 3C Protease Containing a covalently bound…
9U04 1.7 Å, LX-2D6 (Fab) - Polio 1 (VLP) complex
1RA6 2.0 Å, Poliovirus Polymerase Full Length Apo Structure
4NLR 2.0 Å, Poliovirus Polymerase - C290S Loop Mutant
4NLS 2.0 Å, Poliovirus Polymerase - S288A Loop Mutant
1L1N 2.1 Å, Poliovirus 3C proteinase
4NLU 2.1 Å, Poliovirus Polymerase - G289A Loop Mutant
4NLW 2.1 Å, Poliovirus Polymerase - G289A/C290I Loop Mutant
1HXS 2.2 Å, Crystal structure of mahoney strain of poliovirus at 2.2A resolution
4NLO 2.2 Å, Poliovirus Polymerase - C290I Loop Mutant
4NLP 2.2 Å, Poliovirus Polymerase - C290V Loop Mutant
2IM0 2.25 Å, Crystal structure of poliovirus polymerase complexed with CTP and Mg2+

Browse structure collections

About this viewer

MolViewer shows 1RDR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.