1RF3: TNF receptor associated factor 3

Structurally Distinct Recognition Motifs in Lymphotoxin-B Receptor and CD40 for TRAF-mediated Signaling. Determined by X-ray diffraction at 3.5 Å resolution. Released 6 Jul 2004.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,709
Mol. weight: 25.42 kDa
Released: 6 Jul 2004

Explore 1RF3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RF3 contains 4 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	316-340	25
α-helix	344-347	4
β-strand	355-359	5	1
α-helix	361-370	10
β-strand	376	1	2
β-strand	381-382	2	3
β-strand	389-390	2	3
β-strand	393-395	3	2
β-strand	408-410	3	2
β-strand	413	1	3
β-strand	414	1	4
β-strand	430	1	5
β-strand	432-434	3	1
β-strand	445-446	2	1
β-strand	464	1	4
β-strand	472	1	2
α-helix	476-480	5
β-strand	489-493	5	1
β-strand	496	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor associated factor 3	A	protein	200	Homo sapiens	Q13114 (AlphaFold model)
24-residue peptide from Lymphotoxin-B Receptor	B	protein	24		P36941 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RF3_1 TNF receptor associated factor 3 (chains A)
NTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGK
TLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL
MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFI
KVIVDTSDLPDPLEHHHHHH

Sequence of entity 2 (B), FASTA

>1RF3_2 24-residue peptide from Lymphotoxin-B Receptor (chains B)
PYPIPEEGDPGPPGLSTPHQEDGK

Primary citation

Structurally distinct recognition motifs in lymphotoxin-beta receptor and CD40 for tumor necrosis factor receptor-associated factor (TRAF)-mediated signaling. Li, C., Norris, P.S., Ni, C.Z. et al. J Biol Chem (2003) 278:50523-50529. DOI 10.1074/jbc.M309381200 · PubMed

Other PDB entries of the same protein (UniProt Q13114 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8T5P 2.5 Å, SARS-CoV-2 ORF3a peptide in complex with TRAF3 TRAF domain
2GKW 2.7 Å, Key contacts promote recongnito of BAFF-R by TRAF3
1FLK 2.8 Å, Molecular basis for CD40 signaling mediated by TRAF3
1ZMS 2.8 Å, LMP1 Protein binds to TRAF3 as a structural CD40
8ZUK 2.83 Å, Cluster structure of the BAFF-BAFFR-TRAF3 complex
1L0A 2.9 Å, Downstream regulator tank binds to the CD40 recognition site on TRAF3
1FLL 3.5 Å, Molecular basis for CD40 signaling mediated by TRAF3
1KZZ 3.5 Å, Downstream regulator tank binds to the CD40 recognition site on TRAF3
2ECY Solution structure of the Zinc finger, C3HC4 type (RING finger)" domain of TNF…

Browse structure collections

About this viewer

MolViewer shows 1RF3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.