1RHO: Rho guanine nucleotide dissociation inhibitor

Name: PDB 1RHO: Structure of rho guanine nucleotide dissociation inhibitor
Published: 1997-10-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: inhibitor

Structure of rho guanine nucleotide dissociation inhibitor. Determined by X-ray diffraction at 2.5 Å resolution. Released 15 Oct 1997.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,663
Mol. weight: 50.72 kDa
Released: 15 Oct 1997

Explore 1RHO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RHO contains 8 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	70-78	9	1
β-strand	87-89	3	1
α-helix	95-99	5
β-strand	102-105	4	2
β-strand	109-110	2	3
β-strand	111-118	8	1
β-strand	123-134	12	2
β-strand	137-149	13	2
β-strand	156-159	4	1
α-helix	160-162	3
β-strand	163-164	2	3
β-strand	173-182	10	2
β-strand	190-199	10	2

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	70-78	9	4
β-strand	87-89	3	4
α-helix	96-99	4
β-strand	102-105	4	5
β-strand	109-110	2	6
β-strand	111-118	8	4
β-strand	123-134	12	5
β-strand	137-149	13	5
α-helix	155	1
β-strand	156-159	4	4
α-helix	160-162	3
β-strand	163-164	2	6
β-strand	173-182	10	5
β-strand	190-199	10	5

Chain C: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	70-78	9	7
β-strand	87-89	3	7
α-helix	96-99	4
β-strand	102-105	4	8
β-strand	109-110	2	9
β-strand	111-118	8	7
α-helix	122	1
β-strand	123-134	12	8
β-strand	137-149	13	8
α-helix	155	1
β-strand	156-159	4	7
β-strand	163-164	2	9
β-strand	173-182	10	8
β-strand	190-199	10	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho GDP-dissociation inhibitor 1	A, B, C	protein	145	Homo sapiens	P52565 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1RHO_1 RHO GDP-DISSOCIATION INHIBITOR 1 (chains A, B, C)
VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRV
NREIVSGMKYIEHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIK
SRFTDDDKTDHLSWEWNLTIKKDWK

Primary citation

A modulator of rho family G proteins, rhoGDI, binds these G proteins via an immunoglobulin-like domain and a flexible N-terminal arm. Keep, N.H., Barnes, M., Barsukov, I. et al. Structure (1997) 5:623-633. DOI 10.1016/S0969-2126(97)00218-9 · PubMed

Other PDB entries of the same protein (UniProt P52565 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KMT 1.3 Å, Crystal structure of RhoGDI Glu(154,155)Ala mutant
1QVY 1.6 Å, Crystal structure of RhoGDI K(199,200)R double mutant
2JHX 1.6 Å, Crystal structure of rhogdi E155H, E157H mutant
2JHU 1.65 Å, Crystal structure of rhogdi E154A,E155A mutant
2JHT 1.88 Å, Crystal structure of rhogdi K135T,K138T,K141T mutant
2JHY 1.9 Å, Crystal structure of rhogdi E155H, E157H mutant
2JHS 1.95 Å, Crystal structure of rhogdi K135H,K138H,K141H mutant
1FSO 2.0 Å, Crystal structure of truncated human rhogdi quadruple mutant
2JHV 2.07 Å, Crystal structure of rhogdi E154A,E155A mutant
2JI0 2.1 Å, Crystal structure of rhogdi K138Y, K141Y mutant
2JHZ 2.2 Å, Crystal structure of rhogdi E155S, E157S mutant
2BXW 2.4 Å, Crystal structure of rhogdi Lys(135,138,141)Tyr mutant

Browse structure collections

About this viewer

MolViewer shows 1RHO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.