NMR Structure of CXC Chemokine CXCL11/ITAC. Determined by solution NMR. Released 13 Apr 2004.
Explore 1RJT in 3D Show helices and sheets RCSB PDB PDBe
1RJT contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21 | 1 | 1 |
| β-strand | 24 | 1 | 1 |
| β-strand | 27 | 1 | 2 |
| β-strand | 31 | 1 | 3 |
| β-strand | 40 | 1 | 3 |
| β-strand | 43 | 1 | 2 |
| α-helix | 61-68 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Small inducible cytokine B11 | A | protein | 73 | O14625 (AlphaFold model) |
>1RJT_1 Small inducible cytokine B11 (chains A) FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQ ARLIIKKVERKNF
NMR structure of CXCR3 binding chemokine CXCL11 (ITAC). Booth, V., Clark-Lewis, I., Sykes, B.D. Protein Sci (2004) 13:2022-2028. DOI 10.1110/ps.04791404 · PubMed
Other PDB entries of the same protein (UniProt O14625 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1RJT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.