1RKL: Yeast oligosaccharyltransferase subunit Ost4p

Name: PDB 1RKL: NMR structure of yeast oligosaccharyltransferase subunit Ost4p
Published: 2004-03-23
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

NMR structure of yeast oligosaccharyltransferase subunit Ost4p. Determined by solution NMR. Released 23 Mar 2004.

Method: Solution NMR
Chains: 1
Atoms: 276
Mol. weight: 3.99 kDa
Released: 23 Mar 2004

Explore 1RKL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RKL contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	9-28	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 4 kDa subunit	A	protein	36		Q99380 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RKL_1 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 4 kDa subunit (chains A)
MISDEQLNSLAITFGIVMMTLIVIYHAVDSTMSPKN

Primary citation

Structural basis for the function of a minimembrane protein subunit of yeast oligosaccharyltransferase. Zubkov, S., Lennarz, W.J., Mohanty, S. Proc Natl Acad Sci U S A (2004) 101:3821-3826. DOI 10.1073/pnas.0400512101 · PubMed

Other PDB entries of the same protein (UniProt Q99380 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AGE 2.8 Å, Structure of yeast oligosaccharylransferase complex with acceptor peptide bound
8AGB 3.0 Å, Structure of yeast oligosaccharylransferase complex with lipid-linked oligosaccharide…
8AGC 3.1 Å, Structure of yeast oligosaccharylransferase complex with lipid-linked oligosaccharide…
6EZN 3.3 Å, Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex
7OCI 3.46 Å, Cryo-EM structure of yeast Ost6p containing oligosaccharyltransferase complex
6C26 3.5 Å, The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex
6XCR NMR structure of Ost4 in DPC micelles
6XCU NMR structure of Ost4V23D, a critical mutant of Ost4, in DPC micelles

Browse structure collections

About this viewer

MolViewer shows 1RKL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.