6XCU: Oligosaccharyltransferase

NMR structure of Ost4V23D, a critical mutant of Ost4, in DPC micelles. Determined by solution NMR. Released 10 Feb 2021.

Method: Solution NMR
Organism: Saccharomyces cerevisiae (strain YJM789)
Chains: 1
Atoms: 304
Mol. weight: 5.23 kDa
Released: 10 Feb 2021

Explore 6XCU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6XCU contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-32	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oligosaccharyltransferase	A	protein	45	Saccharomyces cerevisiae (strain YJM789)	Q99380 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6XCU_1 Oligosaccharyltransferase (chains A)
MISDEQLNSLAITFGIVMMTLIDIYHAVDSTMSPKNRLEHHHHHH

Primary citation

NMR and MD simulations reveal the impact of the V23D mutation on the function of yeast oligosaccharyltransferase subunit Ost4. Chaudhary, B.P., Zoetewey, D.L., McCullagh, M.J. et al. Glycobiology (2021) 31:838-850. DOI 10.1093/glycob/cwab002 · PubMed

Other PDB entries of the same protein (UniProt Q99380 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AGE 2.8 Å, Structure of yeast oligosaccharylransferase complex with acceptor peptide bound
8AGB 3.0 Å, Structure of yeast oligosaccharylransferase complex with lipid-linked oligosaccharide…
8AGC 3.1 Å, Structure of yeast oligosaccharylransferase complex with lipid-linked oligosaccharide…
6EZN 3.3 Å, Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex
7OCI 3.46 Å, Cryo-EM structure of yeast Ost6p containing oligosaccharyltransferase complex
6C26 3.5 Å, The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex
1RKL NMR structure of yeast oligosaccharyltransferase subunit Ost4p
6XCR NMR structure of Ost4 in DPC micelles

Browse structure collections

About this viewer

MolViewer shows 6XCU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.