1RL2: Protein

Name: PDB 1RL2: Ribosomal protein L2 RNA-binding domain from bacillus stearothermophilus
Published: 1999-04-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

Ribosomal protein L2 RNA-binding domain from bacillus stearothermophilus. Determined by X-ray diffraction at 2.3 Å resolution. Released 2 Apr 1999.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Geobacillus stearothermophilus
Chains: 2
Atoms: 2,173
Mol. weight: 29.86 kDa
Released: 2 Apr 1999

Explore 1RL2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RL2 contains 6 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	64	1	1
β-strand	75-83	9	1
α-helix	84-86	3
β-strand	88-95	8	1
β-strand	100-104	5	1
α-helix	105-106	2
β-strand	114-115	2	1
β-strand	117	1	2
β-strand	128-130	3	2
α-helix	131-133	3
α-helix	135	1
β-strand	139-141	3	2
β-strand	143-144	2	3
β-strand	151-153	3	3
β-strand	161-167	7	2
β-strand	170-174	5	2
β-strand	180-184	5	2
β-strand	188-191	4	2

Chain B: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	64	1	4
β-strand	75-83	9	4
β-strand	88-95	8	4
β-strand	100-104	5	4
α-helix	105-106	2
β-strand	114-115	2	4
β-strand	117	1	5
β-strand	128-130	3	5
α-helix	131-133	3
β-strand	139-141	3	5
β-strand	143-144	2	6
β-strand	151-153	3	6
β-strand	161-167	7	5
β-strand	170-174	5	5
β-strand	180-184	5	5
β-strand	188-191	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (ribosomal protein L2)	A, B	protein	137	Geobacillus stearothermophilus	P04257 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1RL2_1 PROTEIN (RIBOSOMAL PROTEIN L2) (chains A, B)
QYRIIDFKRDKDGIPGRVATIEYDPNRSANIALINYADGEKRYIIAPKNLKVGMEIMSGP
DADIKIGNALPLENIPVGTLVHNIELKPGRGGQLVRAAGTSAQVLGKEGKYVIVRLASGE
VRMILGKCRATVGEVGN

Primary citation

The three-dimensional structure of the RNA-binding domain of ribosomal protein L2; a protein at the peptidyl transferase center of the ribosome. Nakagawa, A., Nakashima, T., Taniguchi, M. et al. EMBO J (1999) 18:1459-1467. DOI 10.1093/emboj/18.6.1459 · PubMed

Other PDB entries of the same protein (UniProt P04257 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1C04 5.0 Å, Identification of known protein and RNA structures in a 5 a map of the large ribosomal…
4V42 5.5 Å, Crystal structure of the ribosome at 5.5 A resolution.
487D 7.5 Å, Seven ribosomal proteins fitted to a CRYO-electron microscopic map of the large 50S…
1ML5 14.0 Å, Structure of the E. coli ribosomal termination complex with release factor 2

Browse structure collections

About this viewer

MolViewer shows 1RL2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.