Ribosomal protein L6. Determined by X-ray diffraction at 2.0 Å resolution. Released 2 Feb 1999.
Explore 1RL6 in 3D Show helices and sheets RCSB PDB PDBe
1RL6 contains 3 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-9 | 2 | 1 |
| β-strand | 15-19 | 5 | 2 |
| β-strand | 22-27 | 6 | 2 |
| β-strand | 30-35 | 6 | 2 |
| β-strand | 41-45 | 5 | 1 |
| β-strand | 48-52 | 5 | 1 |
| α-helix | 58-79 | 22 | |
| β-strand | 82-89 | 8 | 3 |
| β-strand | 94-98 | 5 | 4 |
| β-strand | 101-105 | 5 | 4 |
| β-strand | 112-114 | 3 | 4 |
| β-strand | 120-126 | 7 | 3 |
| β-strand | 129-134 | 6 | 3 |
| α-helix | 137-148 | 12 | |
| α-helix | 152-154 | 3 | |
| β-strand | 160-163 | 4 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (ribosomal protein L6) | A | protein | 177 | Geobacillus stearothermophilus | P02391 (AlphaFold model) |
>1RL6_1 PROTEIN (RIBOSOMAL PROTEIN L6) (chains A) SRVGKKPIEIPAGVTVTVNGNTVTVKGPKGELTRTFHPDMTITVEGNVITVTRPSDEKHH RALHGTTRSLLANMVEGVSKGYEKALELVGVGYRASKQGKKLVLSVGYSHPVEIEPEEGL EIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGIRYEGELVRLKEGKTGK
Ribosomal protein L6: structural evidence of gene duplication from a primitive RNA binding protein. Golden, B.L., Ramakrishnan, V., White, S.W. EMBO J (1993) 12:4901-4908. PubMed
Other PDB entries of the same protein (UniProt P02391 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1RL6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.