1ROC: Histone deposition protein Asf1

Crystal structure of the histone deposition protein Asf1. Determined by X-ray diffraction at 1.5 Å resolution. Released 23 Dec 2003.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,402
Mol. weight: 18.22 kDa
Released: 23 Dec 2003

Explore 1ROC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ROC contains 7 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	4-11	8	1
β-strand	16-17	2	2
α-helix	21	1
β-strand	22-30	9	1
β-strand	38-44	7	2
β-strand	55-62	8	2
α-helix	65-66	2
β-strand	68-76	9	1
α-helix	77-80	4
α-helix	81-83	3
α-helix	87-90	4
β-strand	93-101	9	2
β-strand	104-117	14	2
α-helix	120-124	5
α-helix	132-134	3
β-strand	135-139	5	2
β-strand	145-148	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Anti-silencing protein 1	A	protein	155	Saccharomyces cerevisiae	P32447 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ROC_1 Anti-silencing protein 1 (chains A)
GASIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDS
ILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDE
EELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD

Primary citation

Structure and function of the conserved core of histone deposition protein Asf1. Daganzo, S.M., Erzberger, J.P., Lam, W.M. et al. Curr Biol (2003) 13:2148-2158. DOI 10.1016/j.cub.2003.11.027 · PubMed

Other PDB entries of the same protein (UniProt P32447 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UCB 1.52 Å, Structure of antigen-Fab complex with engineered switch residue region.
2HUE 1.7 Å, Structure of the H3-H4 chaperone Asf1 bound to histones H3 and H4
5UEK 1.7 Å, Structure of antigen-Fab 12E complex with Histone chaperone ASF1
5UEA 1.7 Å, Structure of antigen-Fab complex with Histone chaperone ASF1
6AYZ 2.1 Å, Crystal structure of Asf1-Fab 12E complex
2IDC 2.2 Å, Structure of the Histone H3-Asf1 Chaperone Interaction
4ZBJ 2.25 Å, UBN1 peptide bound to H3.3/H4/Asf1
4EO5 2.35 Å, Yeast Asf1 bound to H3/H4G94P mutant
5EII 2.44 Å, Structural determination of an protein complex of a Fab with increased solubility
6AZ2 2.48 Å, Crystal structure of Asf1-Fab 12E complex
4RRP 2.79 Å, Crystal Structure of the Fab complexed with antigen Asf1p, Northeast Structural Genomics…
9AWE 2.8 Å, The crystal structure of an engineered Protein GF with Human Kappa Fab

Browse structure collections

About this viewer

MolViewer shows 1ROC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.