Crystal structures of the catalytic domain of phosphodiesterase 4B2B complexed with AMP. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Dec 2004.
Explore 1ROR in 3D Show helices and sheets RCSB PDB PDBe
1ROR contains 48 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 160-169 | 10 | |
| α-helix | 170-172 | 3 | |
| α-helix | 180-186 | 7 | |
| α-helix | 191-202 | 12 | |
| α-helix | 205-208 | 4 | |
| α-helix | 213-225 | 13 | |
| α-helix | 236-249 | 14 | |
| α-helix | 253-255 | 3 | |
| α-helix | 261-273 | 13 | |
| α-helix | 283-288 | 6 | |
| α-helix | 292-296 | 5 | |
| α-helix | 302-313 | 12 | |
| α-helix | 314-316 | 3 | |
| α-helix | 328-343 | 16 | |
| α-helix | 347-349 | 3 | |
| α-helix | 350-362 | 13 | |
| α-helix | 377-392 | 16 | |
| α-helix | 395-397 | 3 | |
| α-helix | 400-423 | 24 | |
| α-helix | 426-429 | 4 | |
| α-helix | 439-446 | 8 | |
| α-helix | 447-451 | 5 | |
| α-helix | 452-461 | 10 | |
| α-helix | 467-483 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 160-169 | 10 | |
| α-helix | 170-172 | 3 | |
| α-helix | 180-185 | 6 | |
| α-helix | 191-202 | 12 | |
| α-helix | 205-208 | 4 | |
| α-helix | 213-225 | 13 | |
| α-helix | 236-250 | 15 | |
| α-helix | 253-255 | 3 | |
| α-helix | 261-273 | 13 | |
| α-helix | 283-288 | 6 | |
| α-helix | 292-296 | 5 | |
| α-helix | 302-313 | 12 | |
| α-helix | 314-316 | 3 | |
| α-helix | 328-343 | 16 | |
| α-helix | 347-349 | 3 | |
| α-helix | 350-362 | 13 | |
| β-strand | 366 | 1 | 1 |
| β-strand | 372 | 1 | 1 |
| α-helix | 377-392 | 16 | |
| α-helix | 395-397 | 3 | |
| α-helix | 400-423 | 24 | |
| α-helix | 427-429 | 3 | |
| α-helix | 439-446 | 8 | |
| α-helix | 447-451 | 5 | |
| α-helix | 452-461 | 10 | |
| α-helix | 467-481 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cAMP-specific 3',5'-cyclic phosphodiesterase 4B | A, B | protein | 378 | Homo sapiens | Q07343 (AlphaFold model) |
>1ROR_1 cAMP-specific 3',5'-cyclic phosphodiesterase 4B (chains A, B) MSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFR ISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVFTDLEILAAIFA AAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIFMNLTKKQ RQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMVHC ADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYI VHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQAPAPPLDEQNRDCQGLMEKFQFEL TLDEEDSEGPEKEGEGHS
Crystal structures of the catalytic domain of phosphodiesterase 4B complexed with AMP, 8-Br-AMP, and rolipram. Xu, R.X., Rocque, W.J., Lambert, M.H. et al. J Mol Biol (2004) 337:355-365. DOI 10.1016/j.jmb.2004.01.040 · PubMed
Other PDB entries of the same protein (UniProt Q07343 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ROR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.