1RPY: Dimeric SH2 domain of aps

Crystal structure of the dimeric SH2 domain of aps. Determined by X-ray diffraction at 2.3 Å resolution. Released 23 Dec 2003.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,400
Mol. weight: 26.07 kDa
Released: 23 Dec 2003

Explore 1RPY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RPY contains 8 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	404-406	3
β-strand	410	1	1
α-helix	416-424	9
α-helix	427-430	4
β-strand	434-438	5	1
β-strand	446-452	7	1
β-strand	455-460	6	1
α-helix	469-486	18

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	410	1	2
α-helix	416-424	9
α-helix	427-430	4
β-strand	434-438	5	2
β-strand	446-452	7	2
β-strand	455-461	7	2
α-helix	469-486	18
α-helix	490-492	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
adaptor protein APS	A, B	protein	114	Rattus norvegicus	Q9Z200 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1RPY_1 adaptor protein APS (chains A, B)
GSHMELELSDYPWFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKA
KHLRLSLNGHGQCHVQHLWFQSVFDMLRHFHTHPIPLESGGSADITLRSYVRAQ

Primary citation

Structural basis for recruitment of the adaptor protein APS to the activated insulin receptor. Hu, J., Liu, J., Ghirlando, R. et al. Mol Cell (2003) 12:1379-1389. DOI 10.1016/S1097-2765(03)00487-8 · PubMed

Other PDB entries of the same protein (UniProt Q9Z200 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YVH 2.05 Å, Crystal Structure of the c-Cbl TKB Domain in Complex with the APS pTyr-618 Phosphopeptide
1RQQ 2.6 Å, Crystal Structure of the Insulin Receptor Kinase in Complex with the SH2 Domain of APS

Browse structure collections

About this viewer

MolViewer shows 1RPY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.